KEGG   Pseudomonas fluorescens F113: PSF113_4683Help
Entry
PSF113_4683       CDS       T01734                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pfe  Pseudomonas fluorescens F113
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5448051..5449010
Genome map
AA seq 319 aa AA seqDB search
MASHGLILALGLLVGSSVTAHAEPLDEPLKPLPPIPTLDPKRVQLGLRLFNDPRLSVNNT
LSCASCHRLDKGGADDKPFSLGFDGKPVEVNTPTVFNASLNFHQFWDGRVDTLEEQVHVV
VTSPVEMGSTWESVVERIADDPGYTKDFKDAYPDGVTKLNIQGALADYERSLLTPNSRFD
QYLLGNTDALTPREKFGYQRFKEYGCIACHQGVNIGGNMFQKFGIMGDYIADRGNPTRAD
EGRFNITGDENDRQVFKVPSLRNVAVTAPYFHGSSAPTLERAVEVMFKYQLGREPLKNDT
ELIVEFLKTLTGEWEGKPL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacatggactgattctggctctcggcctgctcgtgggatcaagcgtgaccgct
cacgccgaaccactggatgaacccctcaaacccctgcccccgattccgaccctggacccc
aagcgcgtccaactggggctgcggctgttcaatgaccctcgcctgtcggtcaacaacacc
ctgtcctgcgccagttgccatcgcctggacaagggcggcgccgacgacaagccgttttcc
ttggggttcgatggcaagccggtggaggtcaacacccctaccgtgttcaatgccagcctg
aacttccaccagttctgggatggccgcgtcgacacgctggaagaacaggtccacgtggtc
gtgaccagcccggtggaaatgggcagcacctgggaatcggtcgtcgagcgcattgccgat
gacccgggctataccaaggacttcaaggacgcttaccccgacggcgtgaccaagctcaat
atccagggggcactggccgattacgagcgcagcttgctgacacccaattcgcgcttcgac
caatacctgctgggcaataccgacgccctcaccccccgggaaaagttcggttaccagcgc
ttcaaggagtacggctgcatcgcttgccaccagggcgtgaacatcggcggcaacatgttc
cagaaattcggcatcatgggtgactacatcgctgaccggggcaaccccacccgggccgac
gaaggacgcttcaacatcaccggcgatgaaaatgatcgccaggttttcaaggtgccgagc
ctgcgcaacgtggccgtcaccgccccgtatttccatggcagctccgcaccgaccctggag
cgcgcggtggaggtgatgttcaagtatcagttgggccgcgaacccctgaaaaacgatacc
gagctgatcgtcgaattcctcaagaccctgaccggcgagtgggagggcaagcccttatga

DBGET integrated database retrieval system