KEGG   Pseudomonas fluorescens F113: PSF113_4878Help
Entry
PSF113_4878       CDS       T01734                                 

Gene name
folE3
Definition
protein FolE1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5671405..5671965
Genome map
AA seq 186 aa AA seqDB search
MTLSLPQNYREILIGLGENPEREGLLDTPVRAAKAMQYLCHGYEQSVEQIVNGALFASDS
DEMVIVADIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARLVDMFARRLQIQENLT
RQIADAVQQVTQAAGVAVVIEAQHMCMMMRGVEKQNSTMNTSVMLGAFRDSSTTRQEFLQ
LIRRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacgctatccctgccccagaactaccgcgagatccttataggcctgggggaaaacccc
gagcgcgagggtctgctcgataccccggtccgtgccgccaaggccatgcagtacctctgc
catggctatgaacaaagcgtcgagcagatcgtcaacggcgcgctgttcgcctctgacagc
gatgaaatggtgatcgtcgccgacatcgaactctattcactctgcgaacatcacctgttg
cccttcatcggcaaggcccatgtggcttatattcctacgggcaaggtcctggggctgtcg
aagatcgcccggctggtggacatgttcgcccgccgcctgcaaatccaggagaacctgacc
cggcaaatcgccgacgcggtgcagcaggtcacccaggccgccggcgtggcggtggtgatc
gaggcccagcacatgtgcatgatgatgcgcggtgtcgaaaaacagaactcgaccatgaac
acctcggtgatgctcggcgcttttcgcgactccagcaccacgcgccaggagttcctgcaa
ttgattcgacggagcaagtaa

DBGET integrated database retrieval system