KEGG   Pseudomonas fluorescens F113: PSF113_4887Help
Entry
PSF113_4887       CDS       T01734                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00480  Glutathione metabolism
pfe00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSF113_4887
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSF113_4887
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSF113_4887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEV64876
UniProt: G8QBS8
Position
complement(5679515..5679997)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLKALDGQELALAPFKGQVVLVVNVASKCGLTPQYAALENLYQQYKAKGFSVL
GLPCNQFAGQEPGSEQEIQDFCSLNYGVTFPLSSKLDVNGHERHQLYRLLAGEGAEFPGD
ITWNFEKFLLGKDGRVLARFSPRTAPDDPAVIQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttccacgaccttaaactcaaagccctggatggtcaggagcttgctctggcg
ccgttcaaggggcaagtcgtgctggtggtcaacgtcgcctccaaatgtggcctgacacct
cagtacgcggcgctggaaaatctttatcagcaatacaaggccaaggggttcagcgtactg
ggcctgccctgcaatcagttcgccgggcaagagccggggagcgagcaggaaatccaggat
ttttgcagcctcaactatggtgtgaccttcccgctgtccagcaagctggacgtgaacggt
catgagcgtcaccagttgtaccgcctgctggcgggcgagggggccgagtttcccggggac
attacctggaacttcgaaaaattcctgctcggcaaggacggtcgggtactggcgcgtttc
tcaccgcgtacggcgccggatgatcctgctgtgatccaggcgatcgaaaaagcgctgggc
tga

DBGET integrated database retrieval system