KEGG   Pseudomonas fluorescens F113: PSF113_4930Help
Entry
PSF113_4930       CDS       T01734                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00900  Terpenoid backbone biosynthesis
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSF113_4930
Enzymes [BR:pfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSF113_4930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEV64919
UniProt: G8QBX1
Position
5721514..5722365
Genome map
AA seq 283 aa AA seqDB search
MSAARLTLPSPAKLNLMLHILGRRPDGYHELQTIFQFLDYGDEITFAVRDDGVIRLHTEF
EGVPHDSNLIVKAAKKLQAQSGCPLGIDIWIEKILPMGGGIGGGSSNAATTLLGLNHLWQ
LGWDVDRLAALGLTLGADVPVFVRGHAAFAEGVGEKLTPVEPEEPWYLVLVPQVSVSTAE
IFSDPLLTRNSPPIKVRPVPKGNSRNDCLPVVARRYPDVRNALNLLGKFTEAKLTGTGSC
VFGGFPSKAEADKVSALLTETLTGFVAKGSNVSMLHRKLQDLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcacgcctgaccctgccctccccggccaagctcaacctgatgctgcacatc
ctcggccgtcgcccggacggctaccacgaactgcagacgatttttcagttcctggactat
ggcgacgaaatcacctttgccgtgcgcgacgacggcgtgattcgcctgcacaccgaattc
gaaggcgttccccacgacagcaacctgatcgtcaaggccgcgaaaaaactccaggcgcaa
tccggttgtccgttgggcatcgatatctggatcgaaaaaatcctgcccatgggcggtggc
atcggtggcggcagctcgaatgcggcaacgactttattgggcctcaaccatttgtggcag
ctgggctgggacgtggatcgcctggcggccctgggcctgacactgggcgccgacgtgccg
gttttcgtgcgtggccacgccgctttcgccgagggcgtaggggaaaaactcaccccggtg
gaacccgaagaaccctggtacttggtgctggtgccgcaagtatctgtaagtacagcagaa
attttttcagatccactgttgacacgtaactctcctcccattaaagtgcgccccgttccc
aagggaaacagtcgaaatgactgcttaccggtggtagcaaggcgttatccagatgttcgt
aacgccttgaatttgttaggtaaatttaccgaagcaaaactcaccggaactggaagttgt
gtgtttgggggcttcccaagcaaagctgaagctgataaagtctcggcccttctgacagag
acccttacagggtttgtagcaaaaggaagcaacgtttcgatgttgcatcgcaagctgcaa
gacctgctctaa

DBGET integrated database retrieval system