KEGG   Pseudomonas fluorescens F113: PSF113_5200Help
Entry
PSF113_5200       CDS       T01734                                 

Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSF113_5200
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSF113_5200
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSF113_5200
Enzymes [BR:pfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSF113_5200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6029488..6030852)
Genome map
AA seq 454 aa AA seqDB search
MRYVSTRNSTVQVDFERVALSAIAEDGGLFVPVELPHFEPQDIANWSTLSYDELAYRVMR
PFVGEAIPEADFKRVLKEAGSQFSHRSLAPLHQVDRNEWVLELFHGPTRSSKDFAAQLQA
RLVQYFLRKRGRRAVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVPQDQLQDLQAT
AHPRVHQVALDGSFDECQTLVTQLFRQHEAISFNSSNWVSVMAQLVFYFHAVLQLGGGQR
PIGFSVPAASFAEVYAGYIAQKMGLPITQMIVATNQNDALHQFFLKNHYSRLRASKTLSP
AMDLSIFSNLERFLWELYGHDDQAVSALMHTFETQGEMTIANEFWLQARMIIDSYAVSDE
QTLEEITSLHRDTGYVIDPHTATGVLAARLYRRSLVAPMVTLGEISPIKSAVLLGELGIP
VAAQQRPMSEHGPAQIHRIQPDDLGALHKLLGAL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatgtgagtacccgaaattcaaccgtgcaggtcgacttcgaacgcgtcgcactg
tcggccatcgccgaggacggcgggctgttcgttcccgtcgaactgccgcacttcgaaccc
caggacattgccaattggtcgaccttgtcctacgacgaactggcctatcgggtgatgcgt
ccgttcgtgggcgaggcgatccccgaggccgatttcaagcgggtgctcaaggaggccggc
agccagttcagccatcgctccctggcgccgttgcatcaggtggatcgcaatgaatgggtc
ctggaattgttccatgggccgacccgctcctcgaaggactttgccgcgcaattgcaggcg
cggctggtgcagtacttcctgcgtaaacgcgggcgtcgcgccgtggtgattggcgtcacc
aacggcgacaccggcctggctgccatcgaggccttcaagcactgcgacgagaccgacgtg
gtggtgatttatcccgaggccggcgtaccccaagaccagcttcaagacctgcaagcgacg
gcacatcctcgggttcatcaagtggccctcgatggcagtttcgatgaatgccagaccctg
gtcacccaactgttccgccagcatgaggcgatcagtttcaattccagcaactgggtcagc
gtcatggcgcagttggtgttttatttccatgccgtactgcaactgggcggcggtcagcgg
cccatcggtttcagcgtgccggcggcgagttttgccgaagtctatgccggctacatcgcg
cagaagatgggcttgccgatcacgcagatgatcgtcgccaccaaccagaatgacgcgctg
catcagttctttttgaagaaccactactcgcgattgcgcgccagcaagaccctgtcgccg
gccatggatttgtcgatcttttccaacctggaacggtttctctgggagctctatgggcac
gacgaccaggccgtgagcgcgctgatgcacaccttcgaaacccagggtgaaatgaccatc
gccaacgagttctggttgcaggcgcggatgatcatcgactcgtacgcggtcagcgatgag
cagacgctggaggaaatcacttcgctgcatcgcgacaccggctacgtcatcgacccacac
accgccaccggcgtgctcgcggcgcgtttgtatcggcgtagcctggtggcgccgatggtg
accttgggcgagatatcgcctattaaatcggcggtgttgcttggtgagttggggatcccc
gtggcggcgcaacaacgtccgatgtccgagcatggcccggcgcagattcatcgcatccaa
ccggacgacctcggtgccctccataaactgctcggcgccctataa

DBGET integrated database retrieval system