KEGG   Pseudomonas fluorescens F113: PSF113_5200Help
Entry
PSF113_5200       CDS       T01734                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00260  Glycine, serine and threonine metabolism
pfe00750  Vitamin B6 metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01230  Biosynthesis of amino acids
Module
pfe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSF113_5200
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSF113_5200
Enzymes [BR:pfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSF113_5200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEV65180
UniProt: G8PYZ9
Position
complement(6029488..6030852)
Genome map
AA seq 454 aa AA seqDB search
MRYVSTRNSTVQVDFERVALSAIAEDGGLFVPVELPHFEPQDIANWSTLSYDELAYRVMR
PFVGEAIPEADFKRVLKEAGSQFSHRSLAPLHQVDRNEWVLELFHGPTRSSKDFAAQLQA
RLVQYFLRKRGRRAVVIGVTNGDTGLAAIEAFKHCDETDVVVIYPEAGVPQDQLQDLQAT
AHPRVHQVALDGSFDECQTLVTQLFRQHEAISFNSSNWVSVMAQLVFYFHAVLQLGGGQR
PIGFSVPAASFAEVYAGYIAQKMGLPITQMIVATNQNDALHQFFLKNHYSRLRASKTLSP
AMDLSIFSNLERFLWELYGHDDQAVSALMHTFETQGEMTIANEFWLQARMIIDSYAVSDE
QTLEEITSLHRDTGYVIDPHTATGVLAARLYRRSLVAPMVTLGEISPIKSAVLLGELGIP
VAAQQRPMSEHGPAQIHRIQPDDLGALHKLLGAL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatgtgagtacccgaaattcaaccgtgcaggtcgacttcgaacgcgtcgcactg
tcggccatcgccgaggacggcgggctgttcgttcccgtcgaactgccgcacttcgaaccc
caggacattgccaattggtcgaccttgtcctacgacgaactggcctatcgggtgatgcgt
ccgttcgtgggcgaggcgatccccgaggccgatttcaagcgggtgctcaaggaggccggc
agccagttcagccatcgctccctggcgccgttgcatcaggtggatcgcaatgaatgggtc
ctggaattgttccatgggccgacccgctcctcgaaggactttgccgcgcaattgcaggcg
cggctggtgcagtacttcctgcgtaaacgcgggcgtcgcgccgtggtgattggcgtcacc
aacggcgacaccggcctggctgccatcgaggccttcaagcactgcgacgagaccgacgtg
gtggtgatttatcccgaggccggcgtaccccaagaccagcttcaagacctgcaagcgacg
gcacatcctcgggttcatcaagtggccctcgatggcagtttcgatgaatgccagaccctg
gtcacccaactgttccgccagcatgaggcgatcagtttcaattccagcaactgggtcagc
gtcatggcgcagttggtgttttatttccatgccgtactgcaactgggcggcggtcagcgg
cccatcggtttcagcgtgccggcggcgagttttgccgaagtctatgccggctacatcgcg
cagaagatgggcttgccgatcacgcagatgatcgtcgccaccaaccagaatgacgcgctg
catcagttctttttgaagaaccactactcgcgattgcgcgccagcaagaccctgtcgccg
gccatggatttgtcgatcttttccaacctggaacggtttctctgggagctctatgggcac
gacgaccaggccgtgagcgcgctgatgcacaccttcgaaacccagggtgaaatgaccatc
gccaacgagttctggttgcaggcgcggatgatcatcgactcgtacgcggtcagcgatgag
cagacgctggaggaaatcacttcgctgcatcgcgacaccggctacgtcatcgacccacac
accgccaccggcgtgctcgcggcgcgtttgtatcggcgtagcctggtggcgccgatggtg
accttgggcgagatatcgcctattaaatcggcggtgttgcttggtgagttggggatcccc
gtggcggcgcaacaacgtccgatgtccgagcatggcccggcgcagattcatcgcatccaa
ccggacgacctcggtgccctccataaactgctcggcgccctataa

DBGET integrated database retrieval system