KEGG   Pseudomonas fluorescens F113: PSF113_5365Help
Entry
PSF113_5365       CDS       T01734                                 

Gene name
folK2
Definition
protein FolK (EC:2.7.6.3 2.7.7.-)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSF113_5365 (folK2)
Enzymes [BR:pfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSF113_5365 (folK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6203309..6203827)
Genome map
AA seq 172 aa AA seqDB search
MSLTQVFLGLGSNIERETHLCAGLEALAGFLVDMRCSAVFESQPVGIKSGPFFNFVVSAF
TNLPLMELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGEQIGNFDGLILPRAEILKNAF
VLWPLSLIAPDRIHPGVGKSFATLWEEAQIDQVLAPVAFEWRGQPLTPSNLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgactcaggtttttctcgggctcggcagcaatatcgagcgcgaaacccatctg
tgcgccggtctggaggccttggccggtttcctggtggacatgcgctgttcggcggtgttc
gagagccagccggtgggtatcaagagcgggccattcttcaattttgtcgtctcggccttc
acgaatctgccgctgatggagctggatcgtcgcctcaagttcatcgaggcggacaacggt
cgctatgcgccggaccgcaagggactgccgctggatatcgacgtgttgttgtatggcgaa
cagatcggcaacttcgatgggttgatcctgccgcgtgcggaaatcctcaagaacgccttc
gtcctgtggcctttgtcgttgatcgcgccggatcgaattcatccaggcgtgggcaagagc
ttcgccacgttgtgggaagaagcgcaaatcgaccaggtgctggcgcctgtggctttcgag
tggcgaggccagccgcttacgccatcgaatctgctgtga

DBGET integrated database retrieval system