KEGG   Pseudomonas fluorescens F113: PSF113_5365Help
Entry
PSF113_5365       CDS       T01734                                 

Gene name
folK2
Definition
protein FolK (EC:2.7.6.3 2.7.7.-)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6203309..6203827)
Genome map
AA seq 172 aa AA seqDB search
MSLTQVFLGLGSNIERETHLCAGLEALAGFLVDMRCSAVFESQPVGIKSGPFFNFVVSAF
TNLPLMELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGEQIGNFDGLILPRAEILKNAF
VLWPLSLIAPDRIHPGVGKSFATLWEEAQIDQVLAPVAFEWRGQPLTPSNLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgactcaggtttttctcgggctcggcagcaatatcgagcgcgaaacccatctg
tgcgccggtctggaggccttggccggtttcctggtggacatgcgctgttcggcggtgttc
gagagccagccggtgggtatcaagagcgggccattcttcaattttgtcgtctcggccttc
acgaatctgccgctgatggagctggatcgtcgcctcaagttcatcgaggcggacaacggt
cgctatgcgccggaccgcaagggactgccgctggatatcgacgtgttgttgtatggcgaa
cagatcggcaacttcgatgggttgatcctgccgcgtgcggaaatcctcaagaacgccttc
gtcctgtggcctttgtcgttgatcgcgccggatcgaattcatccaggcgtgggcaagagc
ttcgccacgttgtgggaagaagcgcaaatcgaccaggtgctggcgcctgtggctttcgag
tggcgaggccagccgcttacgccatcgaatctgctgtga

DBGET integrated database retrieval system