KEGG   Pseudomonas fluorescens F113: PSF113_5406Help
Entry
PSF113_5406       CDS       T01734                                 

Gene name
glcB
Definition
(GenBank) GlcB
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00620  Pyruvate metabolism
pfe00630  Glyoxylate and dicarboxylate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSF113_5406 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSF113_5406 (glcB)
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSF113_5406 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEV65378
UniProt: G8Q1D9
Position
6252261..6254438
Genome map
AA seq 725 aa AA seqDB search
MTEHVQVGGLQVAKVLFDFVNNEAIPGTGLTADAFWVGADKVIHDLAPKNKALLAKRDDF
QARIDAWHQARAGQAHDAVAYKAFLQDIGYLLPEAADFQATTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTAYKIVDGKLVVTLKGGSNSGLRDDAQLIGFQGDASAPTTVLLKHNGLHF
EIQIDASTPVGQTDAAGVKDILMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVAKGGQTFTRTMNPDRVYTAVDGSSVTLHGRSLLFVRNVGHLMTIDAILDQHGNEVP
EGILDGLITSLAAIHSLNGNTSRRNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLNL
PRNTLKVGIMDEERRTTVNLKACIKAASERVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAEKWIGAYENWNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAKRARASVDDILTIPLAVNPNWTPEQIKNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHIANWLRHGIVTQDQVMESL
KRMAPVVDRQNASDPLYRPLAPDFDRNIAFQAAVELVIEGTKQPNGYTEPVLHRRRREFK
AANGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aataacgaagccattcccggaaccggcctcaccgccgacgcgttctgggtcggtgccgac
aaggtcatccacgacctggcgccgaagaacaaagccctactcgccaaacgcgatgatttc
caggcgcggatcgatgcctggcaccaggcccgtgccggccaggcccacgacgccgtggct
tacaaagccttcctgcaagacattggatacctgctgccagaagcggcggatttccaggcc
acgacccaaaacgtcgacgatgaaatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaacgcccgcttcgccctcaacgcatcgaacgcccgctggggttcgctgtatgac
gcgctgtacggcaccgacgccatcagcgaagccgatggcgcggaaaaaggcaaaggctac
aacaaggtccgcggcgacaaggtcatcgccttcgcccgtgccttcctcgacgaagccgcg
ccgctggcggccggttcccacgtcgattccaccgcttacaaaatcgtcgacggcaaactg
gtggtcaccctcaagggcggcagcaacagcggcctgcgtgacgatgcccagttgatcggc
ttccagggcgacgcctcggcaccgaccactgtgctgctgaaacacaacggcctgcacttc
gaaatccagatcgatgccagcactccggtcggccagaccgacgcagccggcgtcaaagac
atcctgatggaagcagcgctgaccaccatcatggactgcgaagactcggtcgccgctgtc
gatgccgatgacaaagtggtgatctaccgcaactggctcggcctgatgaagggcgatctg
gctgaagaagtcgccaaaggcggccagacgtttacccgcaccatgaaccccgaccgtgtc
tataccgccgtcgacggttcgagcgtgaccctgcacggccgctcgctgctgttcgtgcgt
aacgtcggccacctgatgaccatcgacgcgatcctggaccagcacggcaacgaagtgccg
gaaggcatcctcgatggcctgattaccagcctggcggcgatccacagcctcaacggcaac
acctcgcgccgcaacagccgcaccggctcggtgtacatcgtcaagccgaagatgcacggc
ccggaagaagccgcgttcaccaacgaactgttcggtcgcgtcgaggacgtgctgaacctg
ccgcgcaacaccctcaaggtcgggatcatggacgaggagcgccgtaccacggtcaacctc
aaggcctgcatcaaggccgccagcgagcgcgtggtgttcatcaacaccggcttcctcgac
cgtaccggcgatgaaatccacacctccatggaagccggcccgatggtgcgcaaggccgac
atgaaagccgagaagtggatcggcgcgtatgaaaactggaacgtcgacatcggcttgagc
accggcctgcaaggccgtgcacaaatcggcaagggcatgtgggcgatgccggacctgatg
gcggcgatgctcgaacagaaaatcgctcatccgctggccggcgccaacaccgcatgggtt
ccctcgccgaccgccgcggccctgcacgcgctgcattaccacaaggtcgacgtgttcgct
cgtcaggccgaactggccaagcgcgcgcgtgcatcggtggacgacatcctgaccatcccg
ctggccgtcaacccgaactggacaccggagcagatcaagaacgaactggacaacaatgcc
cagggcatccttggctacgtggtgcgctggatcgaccagggcgtgggctgctccaaggtg
ccggacatcaacgacatcggcctgatggaagaccgtgcgacgctgcgtatctccagccag
cacatcgccaactggctgcgccacggcatcgtcacccaagaccaggtgatggaaagcctc
aagcgcatggcgccggtggtcgaccgccagaacgccagcgacccgctgtaccggccgctg
gcaccagacttcgaccgcaacatcgccttccaggcggcggtcgagctggtgatcgaaggc
acgaagcagcctaacggctacaccgagccggtactgcaccgtcgtcgtcgcgagttcaag
gcagccaatgggttgtga

DBGET integrated database retrieval system