KEGG   Pseudomonas fluorescens F113: PSF113_5535Help
Entry
PSF113_5535       CDS       T01734                                 

Gene name
pyrB
Definition
(GenBank) PyrB
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00240  Pyrimidine metabolism
pfe00250  Alanine, aspartate and glutamate metabolism
pfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSF113_5535 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSF113_5535 (pyrB)
Enzymes [BR:pfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PSF113_5535 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEV65507
UniProt: G8Q3L1
Position
6406542..6407546
Genome map
AA seq 334 aa AA seqDB search
MTPLETKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGVEQYGVKVYTDMTEGLKDVDVVIMLRL
QRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVI
LNQVTYGIAIRMAVLSMAMSGQTAQRQFDQENAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctctcgaaaccaagcgcccgctgcagctcaacgatcagggccagctgcggcac
ttcctgtccctcgacggcctgcgccgcgagctgctgacggaaatcctcgacactgccgac
tcgttcctcgaagtcggtgcccgggcggtgaagaaagtcccgttgctgcgcggcaagacc
gtgtgcaacgtgttcttcgaaaactccacccgcacccgcaccaccttcgaactggcggcc
cagcggctgtcggcggacgtgatcaccctcaacgtgtccacgtcctcggcgagcaagggt
gaaaccctgctcgacaccctgcgcaacctcgaagccatggccgccgacatgttcgtcgtg
cgccacggcgattccggcgcggcgcacttcattgccgaacacgtctgcccgcaagtggcg
atcatcaacggcggcgacggccgtcacgcccacccgacccaaggcatgctggacatgctg
accatccgtcggcacaagggcagcttcgaaaacctgtcagtggccattgtcggcgacatc
ctgcactcgcgggtggcgcgctccaacatgctggccctcaagaccctcggctgcccggac
attcgcgtgatcgcaccgaaaaccctgctgcccatcggggtcgagcaatacggcgtgaag
gtctacaccgacatgaccgaaggcctcaaggatgtggacgtggtgatcatgctgcgcctg
caacgcgagcgcatgaccggcggcctgctgcccagcgaaggcgagttctaccgcctgttc
ggcctgaccaccgcacgcctggccggggccaagccggacgccatcgtcatgcacccgggg
ccgatcaaccgcggcgtggagatcgagtcggcggtggccgacgggccgcactcggtgatt
ctcaaccaggtgacctacggcatcgccatccgcatggccgtgctgtccatggccatgagc
gggcaaacggcccagcgccaattcgaccaggagaacgcccagtga

DBGET integrated database retrieval system