KEGG   Pseudomonas fluorescens F113: PSF113_5577Help
Entry
PSF113_5577       CDS       T01734                                 

Gene name
folA
Definition
protein FolA (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfe00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pfe00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6446283..6446795)
Genome map
AA seq 170 aa AA seqDB search
MNKTLPLSLIAALGENRVIGVDNSMPWHLPGDFKYFKATTLGKPIIMGRKTWDSLGRPLP
GRLNIVVSRQSGLVLEGAQVFSTLEAAVARAEAWALEQGVDELMLIGGAQLYAQALEQAD
RLYLTRVALSPEGDTWFPAFDASQWTLVSNQPNPAEGDKPAYSFEVWEKL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactctccccttaagcctgatcgcagccctcggtgaaaaccgtgtgatcggc
gtcgacaacagcatgccctggcacctgccgggggatttcaaatacttcaaggccaccacc
ctgggcaagccgatcatcatggggcgcaagacctgggattccctcggtcgaccgctgccg
ggacgcctgaacatcgtggtcagtcgccagtcgggcctggtgctggagggcgcgcaagtg
ttctccaccctggaagctgcggtggcgcgggccgaggcgtgggcgctggagcagggcgtc
gacgaattgatgctgatcggcggcgcccaactgtacgcccaggccctggaacaggcggat
cgactgtacctgacccgtgtggcgctgagcccggaaggggatacgtggtttccggcattt
gatgcgagccagtggacgctggtctcgaaccagccgaacccggccgaaggggacaagccg
gcctacagctttgaggtgtgggaaaagctgtaa

DBGET integrated database retrieval system