KEGG   Pseudomonas fluorescens F113: PSF113_5686Help
Entry
PSF113_5686       CDS       T01734                                 

Gene name
hemB
Definition
HemB protein (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSF113_5686 (hemB)
Enzymes [BR:pfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PSF113_5686 (hemB)
Exosome [BR:pfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSF113_5686 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6558904..6559917)
Genome map
AA seq 337 aa AA seqDB search
MSFTPANRLFPATRLRRNRRDEFSRRLVRENVLTTNDLILPVFVLDGENRREAVASMPGV
ERLTIDLLLEEAAQWVELGIPALALFPVTPAGLKSLDAAEAWNPEGIAQRATRALRARFP
ELGVITDVALDPFTTHGQDGILDEEGYVQNDITVDALVRQALSHAEAGAQVVAPSDMMDG
RIQAIREALEVAGHVNVRIMAYSAKYASAYYGPFRDAVGSALNLGKANKASYQMDPANSQ
EALHEVAADLSEGADMVMVKPGMPYLDILCRVKDEFKVPTFVYQVSGEYAMHMAAIQNGW
LGEGVILESLTAFKRAGADGILTYFAVRAAQLLREQK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttacccccgccaatcgtctgttccctgctacccgcctgcgtcgcaaccgtcgt
gatgagttctctcgtcggctggtgcgtgaaaacgtgctgaccaccaatgacctgatcctg
ccggtattcgtgctggacggcgagaaccgtcgcgaagcggtggcgtcgatgcccggggtg
gaacgcctgaccatcgacctgctgctcgaagaagccgcccagtgggtcgagctgggcatt
ccggcgctggctttgttcccggttacgcctgcggggctcaagtccctggacgccgccgaa
gcctggaacccggaaggcatcgcccaacgcgcgacccgtgccctgcgcgcgcgctttcca
gaactgggggtgatcaccgacgtggcgctggacccgttcaccacccacgggcaggacggt
atcctcgatgaagaaggctacgtgcagaacgacattaccgtcgatgcactggtcaggcag
gcgctgtcccacgccgaggccggcgcccaggtggtggcgccgtcggacatgatggacggg
cgcatccaggcgatccgcgaagccctcgaggtggccggtcacgtcaacgtgcggatcatg
gcctactcggccaagtacgccagcgcctactacggtccgttccgcgacgcggttggctcg
gccctgaacctgggcaaggccaacaaggcctcttatcagatggacccggccaacagtcag
gaagccttgcacgaagtggcggctgacttgtcagaaggggcagacatggtcatggtcaag
cctggcatgccttacctcgacattctttgccgggtcaaagacgaattcaaagtgccgacc
tttgtttatcaggtcagcggcgagtacgcgatgcacatggccgcgatccagaacggctgg
ttgggcgaaggggtgatcctggagtccttgaccgctttcaaacgcgcaggtgctgatggc
atcctgacttactttgctgtgcgcgccgcccaattgttacgagagcagaaatag

DBGET integrated database retrieval system