KEGG   Pseudomonas fluorescens F113: PSF113_5705Help
Entry
PSF113_5705       CDS       T01734                                 

Gene name
hemX
Definition
protein HemX (EC:2.1.1.-)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSF113_5705 (hemX)
Enzymes [BR:pfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PSF113_5705 (hemX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSF113_5705 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6577632..6579548)
Genome map
AA seq 638 aa AA seqDB search
MTGWRLLLTRPADESSALAAVLAEAGVYSSSLPLLDIEPVPLSDAGRAIFQALDQYSAVI
VVSKPAARLCVELLRQYWPQPPDQPWFSVGAATGQILSDAGLTVFYPDNGDDSEALLEHL
VLRQAVARPDPKVLIVRGEGGRGLLAERLREQGASVDYLELYRRHLPDYGEGALPAKVEA
ERLNALVVSSGQGFEHLQRLAGDAWPALARLPLFVPSPRVAEMARATGARTVVDCRGANA
AALLAALREHSVPFSNAKDGYVSETALPKEDLDQPAIDAPVETPPPVVPRRGNGLAVVAL
LLGAAGVAVGGWGVWQVRHLQTNNQQQSAQVQALNDQAQSLKLNEQRLSERLAQLPPAEE
LEERRRLVAQLQSDQQHLNQRLETVLGASRKDWRLAEAEHLLRLASLRLSALQDINSAQA
LVQGADEILREQNDPGSFAAREQLAKTLAALRSTEQPDRTGLFLQLGALRDQVLELTELA
PEYKDRGESLLGLTADGDGASRWAQWWDQISRYIRIDFNADENVRPLLAGQSLVQVRLAL
SLALEQAQWAALNGQAPVYTQALTEARDVLKNNFNQDNPQSKIMLERVGELSKQPVTVVT
PDLTGTLSSVQAYLERRNLNAQESVKPLPAPGAQEATP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggctggcggctgctgctcacccggccggcggacgagtcctcggcgctggcggct
gtcctggccgaagcgggggtctacagcagcagcctgcccttgctggatatcgagccggtc
ccgctgtccgatgccgggcgggcgatattccaggcgctggaccaatactctgccgtgatc
gtcgtcagcaaacctgccgcacgcctgtgcgtcgagttgttgcgccaatactggccccag
cctccagaccaaccctggttcagcgtgggtgcggccaccggacagattctcagcgatgcc
ggcctcacggtgttttatcccgataacggcgatgacagcgaagccctgctggagcatttg
gtcttgcgccaggctgttgcgcggcccgaccccaaggtgttgatcgttcggggtgaaggc
gggcgtggcttgctggcagagcgtttgcgcgagcaaggtgctagtgtcgattatctggaa
ttgtaccgtcgccacttgcccgattacggcgaaggggcgttgccggcgaaagtcgaagcg
gaacgcttgaacgcactggtggtcagcagtgggcagggcttcgagcatctgcagcggttg
gccggcgatgcgtggccggccctggcgcggttaccgttgtttgttccaagcccaagggtt
gccgagatggcgcgtgccaccggggcccgaacagttgtggattgccgtggtgccaatgct
gcggctttgctggcggcgttacgggaacactccgtgccgttttctaatgcaaaggatgga
tacgtgagcgaaacagccttgccaaaagaagatctagaccagcctgcgatcgatgcgccg
gttgaaaccccgcccccagtggtgccgcgtcgcggcaacgggctggccgttgttgccttg
ctgctcggcgctgccggtgtcgccgtaggcggttggggcgtttggcaggtgcgtcacctg
caaaccaataaccagcagcagtccgcccaggtccaggcactgaatgaccaggcccagagc
ctcaagctcaacgagcaacgcctgagcgagcgcctggcgcaattgcccccggccgaagag
ctggaggagcggcggcgcctggtggcccagttgcaaagtgaccagcagcacctgaaccag
cgcctggagaccgtgctcggtgccagccgcaaggattggcgcctggcggaggccgagcac
ttgttgcgcctggccagcctgcgtctttccgccctgcaagacatcaacagtgcccaggcg
ctggtgcagggcgctgacgaaatcctgcgcgagcagaacgaccccggttcgttcgccgcc
cgcgagcaactggccaagaccctcgccgcattgcgcagcaccgaacaaccggatcgcacc
gggctgttcctgcaactgggcgccttgcgtgaccaggtcctggagctgaccgagctggcg
cccgagtacaaggaccgtggtgagtcgcttttgggcctgaccgccgatggcgatggtgcc
agtcgttgggcacagtggtgggaccagatctcgcgctatatccgtatcgacttcaacgcc
gatgagaacgtccgtccgctgctggccgggcaaagccttgtgcaagtgcgcctggccttg
agcctggcgttggagcaggcgcaatgggccgcccttaatggtcaggcgccggtgtacacc
caggcgctgactgaagcccgggacgtgttgaagaacaacttcaaccaggacaacccgcaa
agcaagatcatgctcgaacgcgtgggtgagctgtccaagcagccggtgacggtggtcacc
ccggacctgacgggcacgctgagcagcgtccaggcttaccttgagcgccgcaacctcaat
gcccaggaatcggtcaagccgctgcccgcgcctggcgcgcaggaggctacgccatga

DBGET integrated database retrieval system