KEGG   Pseudomonas fluorescens F113: PSF113_5762Help
Entry
PSF113_5762       CDS       T01734                                 

Gene name
algC
Definition
protein AlgC (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_5762 (algC)
   00030 Pentose phosphate pathway
    PSF113_5762 (algC)
   00051 Fructose and mannose metabolism
    PSF113_5762 (algC)
   00052 Galactose metabolism
    PSF113_5762 (algC)
   00500 Starch and sucrose metabolism
    PSF113_5762 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PSF113_5762 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PSF113_5762 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSF113_5762 (algC)
Enzymes [BR:pfe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSF113_5762 (algC)
    5.4.2.8  phosphomannomutase
     PSF113_5762 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6639560..6640957
Genome map
AA seq 465 aa AA seqDB search
MNTPAAIAPIFPDSIFRAYDIRGVVPETLTAETAYWIGRAIGSQSLAQGEPNVSVGRDGR
LSGPELVEQLIKGVADSGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHTRLKTNDLSSGQGSVTKVDILPRYNDEIVKDVKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCDVDGNFPNHHPDPGKLENLEDLIAKVKETNADLG
LAFDGDGDRVGVVTNTGSVVFPDRLLMLFAKDVVARNPDAEIIFDVKCTRRLVPLIKEYG
GRPLMWKTGHSLIKKKMKQSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFATFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGAELTTIDGVRVDYPHGWG
LVRASNTTPVLVLRFEADNEAELQRIKDVFHTQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccagccgcaatcgccccgatcttccctgacagcatcttccgcgcctacgac
atccgtggcgtggtaccggaaaccctcaccgccgaaaccgcctactggatcggccgcgcc
attggctcccaaagcctggcccagggcgaaccgaatgtgagcgtcggccgtgatggccgc
ttgtcgggccccgagctggtcgaacaactgatcaaaggcgttgccgacagtggctgccac
gtcagcgacgtgggcctggtgccgaccccggcgctttactacgccgccaacgtgttggcc
ggcaagtccggggtgatgctcaccggcagccacaacccatcgaactacaacggcttcaag
atcgtcatcgccggcgacaccctcgccaacgagcagatccaggccctgcatacccgcctc
aagaccaacgacctgagtagcggccagggcagcgtgaccaaggtcgatatccttcctcgc
tacaacgacgagatcgtcaaggacgtgaaactcgcccgtcgcctgaaagtggtggtcgat
tgcggcaacggcgcggctggcgtgatcgccccgcaactgatcgaagccctgaactgcgaa
gtcatcccactgttctgcgacgtggacggcaacttccctaaccaccacccggacccgggc
aagctggaaaacctcgaagacctgatcgccaaggtcaaggaaaccaacgccgacctgggc
ctggccttcgacggcgacggcgaccgcgtgggcgtggtgaccaataccggtagcgtggta
ttcccggaccgcctgctgatgctgtttgccaaggacgtggtggcgcgcaacccggatgcc
gagatcattttcgacgtcaaatgcacccgtcgcctggtgccgctgatcaaggaatatggc
ggtcgtccactgatgtggaaaacgggtcattcgttgatcaagaaaaaaatgaaacagagc
ggtgccctgctggccggcgaaatgagcggccacatcttcttcaaggaacgctggttcggt
tttgacgacggcatctacagcgccgcgcgcttgctggaaatcctcagcaaggagaaatcc
acggccgaagagctgttcgcaaccttcccgaacgatatttctacgccagaaatcaatatc
catgtgaccgaagagagcaaattcagcatcattgatgcactgcacgacgctcaatggggc
gaaggcgccgaactgaccaccatcgatggtgtgcgggtcgactatccccacggctggggc
ctggttcgcgcatccaacaccacaccggtgctggtactgcgtttcgaggccgacaacgag
gctgaactgcagcgcatcaaggatgtgttccacacccaactcaaacgtgttgcacctgat
ctccaactaccgttttga

DBGET integrated database retrieval system