KEGG   Plasmodium falciparum HB3: PFHG_00119Help
Entry
PFHG_00119        CDS       T01052                                 

Definition
hypothetical protein similar to arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfh01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pfh00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 419 aa AA seqDB search
MLDTIESYIKSHKEKENLYVKKNVSIIGSPLAAGQPLGGVQLACDDLRKLGLHNVIDVLG
WKYEDIGNIDNGDNEMKQEKKTNNYINNNDNNNDNNNDNNNDNNNDNNNDNNNNCYIPNG
VIKEKKHDLSNNKMNGYVNHNFYGNYEENNVISTNDKYKNNCYYDNIRNIKEIGIFSKNL
FDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPETSPSGNY
HGMTLAHTLGLFKKKVPYFEWSEKLTYLKPENTAIIGIRDIDAYEKIILKKCNINYYTIF
DIEKNGIYNTICTALEKIDPNSNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLM
KILAETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLELIARVLGYDIV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgttggatactatagaaagttacatcaaaagtcacaaggaaaaggaaaacctttatgtt
aagaaaaacgtttccattattggttctcctcttgccgctggtcaacctcttggaggggtg
caattagcatgtgatgacttgagaaaattaggtttgcacaatgttatagatgtgttagga
tggaaatatgaagatataggcaatatagataatggggataatgaaatgaaacaagaaaaa
aaaactaataattatattaataataatgataataataatgataacaataatgataataat
aatgataacaataatgataataataatgataataataataattgttatattcccaatggt
gtaattaaagaaaagaaacatgatttgtcaaataataaaatgaatggatatgtgaaccat
aatttttatggtaattatgaagagaataatgtaatatcaacaaacgataaatataaaaat
aattgttattatgataatataaggaatataaaagaaataggtatattcagtaaaaattta
tttgatactatgagcaatgaattaaggaagaaaaattttgtattaaatatagggggtgac
catggtgtagcttttagtagtatcctgagttccttacaaatgtatcagaatttaagagtt
atatggattgatgcacatggtgatataaacatacctgaaacatctccttcaggtaattat
catggtatgactttagcacacaccttagggttatttaaaaagaaagttccttattttgaa
tggtccgaaaaattaacatatttaaaaccagaaaatacagctattataggtattagagat
atagatgcatatgaaaaaattattttaaaaaaatgtaatattaattattataccattttt
gatatagaaaaaaatggaatctataatacaatatgtacagcattagaaaaaatagatcca
aattcaaattgccctattcacatctctttagatatagatagtgttgataatgtctttgct
ccaggaactggtactgtagctaaggggggattaaattatagagaaattaatttattaatg
aaaatattagctgaaacaaaaagagttgtctctatggatttagtagaatataatccatca
cttgatgaagttgataaaaaagttcatggagattcattgcctatattggataatgcaacg
aaaacaggcaagttgtgtttagaacttatcgcccgagtgttaggatacgatatagtgtaa

DBGET integrated database retrieval system