KEGG   Plasmodium falciparum HB3: PFHG_00173Help
Entry
PFHG_00173        CDS       T01052                                 

Definition
hypothetical protein similar to delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pfh01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfh01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 949 aa AA seqDB search
MIEMILSYVYKSLAGVLHTLNKSYLDIKDIGVTYLTYFIFLISCYLLKNYFSFKFLNFIR
IVKSSIVLIICLISLKYLDLNLTLSINFFYLYNILQLSNFLEVSTSQNKKSNNKSKNVEA
KVINKYELRNENEEKNYELIGDTSKHLEKIAKKILNNKKKLEENECILKEKEIIDEIERK
EKEEEEIMKMKNNLNAKKNKDKRKDKINLYGIYVFFLQTFYIYFFYFFWNYIQNLIIIKI
FLTLQLVKCLISFVSNFWINNMNINLFKRMIHILDIVYMFSISLFFTNILYNISQNTHFL
RNFAVYSIVFHVYYAYVLFVKYIYTYHKQFRSSLFSFILFFHVFGIIGMIKLYYHEYGKS
LLIQCVIFYLINGFGITFGAHRLWSHRAFKAGHIVQVLFLILNSFANQGSVIVWAINHRL
HHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPYLLLQHKLDP
YFNFFFCFIIPGIYSYFMYNNFWDGFFILGALRWIITLHATWSINSASHSFGHRPYNIDI
KPTNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYLINFFYYLGLVWDLKC
AKNICKEVRLRETLKLEKRNKALSENIKNEIMKKEDTSYVIELMNSFKALCNDYLNISTF
MYILYFLRDIVIMITIFLIHICYCYNKYGNGTMFSTISQKFNIENNKYISISLSFFFHII
LYTLPMGTMFASLYALVYECKRELLFKKPLFNHFFGSIISSFILLPYTSEKNRKSVLTAL
NEDFVKILKGPIYFDIYSLIFTFFSVFYIMTYYIFGYFYFCTFFLGPYIVFNAWLLIYIY
LLKNPPFLQMDINTKEVDIGVLNYVAFQSLLQWKKNNSIYQSKKRLYKMVFSFINFIHHH
LCYTHVVEFINASIPSYRTKEIYKHFDKTLDQYNFLRNDKFMDVLKEFL
NT seq 3001 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatgatcttaagttatgtatataaatcgttagcaggtgtattgcacacgtta
aacaaaagttatttagacattaaagacataggtgtaacctatttaacctattttattttt
ttaatttcatgttatttattaaagaattatttttcatttaagtttcttaattttataaga
attgtaaaaagttccatagttctaataatatgtttaataagtttaaaatatttagatttg
aacctgaccttaagtattaactttttttatttatacaacattttacagttaagtaacttt
ttagaagtaagtacatcacaaaataaaaaaagcaataacaaatcaaaaaatgtagaggca
aaagtaattaataaatatgaattaagaaatgaaaatgaagaaaaaaattatgagttaatt
ggagatacatcaaaacatttagaaaaaattgcaaaaaaaatattaaataataaaaaaaaa
ttagaagaaaatgaatgcatattaaaagaaaaagaaattattgatgaaatagaaagaaaa
gaaaaagaagaagaagaaattatgaaaatgaaaaataatcttaatgctaaaaaaaataaa
gataaaagaaaggacaaaataaatttatatggtatttatgttttctttttacaaaccttt
tatatatattttttttatttcttttggaattatattcagaacttgattattataaaaata
ttcttaactttacaattagttaaatgtctcatttcttttgttagtaatttctggataaat
aatatgaatataaatttattcaaaagaatgatacatatattagacatcgtatatatgttt
tctataagtttattttttacaaatattctgtacaatatatcacaaaatacacatttctta
cgtaactttgcagtatactctattgtatttcatgtatattatgcatatgtcctatttgtt
aagtatatatacacatatcataagcagtttagatcatctttattttcttttattttgttc
ttccacgtatttggaataattggaatgataaaattatattatcacgagtatggaaagtca
ttattaattcaggtaacctcatataaaatatatgaacaataaaaaaaaaaatctatatat
atatatatatatatatatatgtatatatgattatgtacatatacacctatatacaattta
tatacatgtatttctttatatatatatatatttttttttttagtgcgtaatattttacct
cataaacggtttcggaataacatttggagctcatcggttatggtcacatagagcatttaa
agctggtcacattgttcaggttttatttttaattttgaatagttttgctaatcaagggag
tgtaatagtttgggccataaatcatcgtttacatcataaatacagtgatacaaaatatga
tcctcataatataagatatggcttcttttatagtcacgttggatggcttttatatcagaa
aacgaaatatgtaaaagaaaaagagaaagaaatttatgtagatgatttattacaaaatcc
ttatcttctcttacaacacaaattagatccatattttaattttttcttttgttttattat
acctggtatatattcatattttatgtataataatttttgggatggattttttatattagg
agctcttcgttggattattactttacatgctacatggtctattaatagtgcatcacattc
ttttggacatagaccctataatattgatataaaaccaaccaataatatttttacatctat
agtagcccttggagaaggatgtcataattatcatcatgtgtttccttactgttatgccat
gaatgaaaatttttatattcttagtataaaccctacgaaatatctgataaattttttcta
ttatttaggtttagtatgggatttaaaatgtgcaaagaatatttgtaaagaagtacgatt
aagagaaacattaaaattagaaaagagaaataaagcattaagtgaaaacattaaaaatga
aataatgaaaaaagaagatacaagttatgttatagaattaatgaattctttcaaagcatt
gtgtaatgattatttaaatatttcaacctttatgtacattttatacttcttaagagatat
tgtaattatgattactatatttttaattcacatatgttactgttataataaatatggaaa
tggtacgatgttttctacaatatcacaaaaatttaatatagaaaataataaatatatatc
aatatcactttcctttttctttcatattattttatatacactacccatgggaactatgtt
tgcaagtttatatgcattagtttatgaatgtaaaagagagctactttttaaaaaaccact
atttaatcatttctttggtagtattatttcatcatttattttgttaccatatacttcaga
gaaaaatagaaaatcagtattaacagcgttgaatgaagatttcgttaaaattttaaaggg
gccaatatattttgacatatattctttaatatttacctttttttcagtattctatataat
gacatattatatatttgggtacttttatttctgtacattttttttaggaccatatattgt
ttttaatgcatggttattaatttatatatatttattaaaaaatcctccatttttacaaat
ggatattaatactaaagaagtggatattggtgttttaaattatgttgctttccaatcatt
acttcaatggaaaaaaaataattcaatatatcaaagtaaaaagaggttatataaaatggt
tttttcatttataaatttcatacatcatcacttatgttatactcatgttgttgaattcat
taatgctagcataccaagttacagaactaaagaaatatataaacattttgataaaacctt
agatcagtataatttcctacgcaatgacaaatttatggacgtactaaaggaattcttatg
a

DBGET integrated database retrieval system