KEGG   Plasmodium falciparum HB3: PFHG_00206Help
Entry
PFHG_00206        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFHG_00206
Enzymes [BR:pfh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     PFHG_00206
Amino acid related enzymes [BR:pfh01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   PFHG_00206
Transfer RNA biogenesis [BR:pfh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PFHG_00206
 Prokaryotic Type
   Other AARSs
    PFHG_00206
Mitochondrial biogenesis [BR:pfh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PFHG_00206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 1184 aa AA seqDB search
MIYVVKYIFLICYINTLFLRRVLFCYSYNLSQHFSLYNNSKFVLFKRNKKRNKINKYHNI
YYHKGGFHYENNIGNNNISNPFFLNKFIYNKKKHKLNFFNSPTSSYDDACILKNLFNSFT
TEGRIKNKKSDKNVKMNVMIKKKCMLYLTFNRKENDNIINNNNNDNNNNNDNNNNNDNNN
NNDNNNYHVDESYLSNIGEPCILLRSTSWGHLSLFYGSHLNRDYYTYEDIIKYIETNEKK
FVKCINNNIYNNNDNNNTDITKQTFIDKKYILIRGRMERKKKQSKRIFLYLRLSNGMYLT
CVYEKKIPTNKNNQSIYSIDNMYTYIKNLKNESVIDVVGRIKLHGTLYKHNISYIESLLN
QTVIELVAEQINCISESFYNPPFMINDNDVHTKKIQMVIRGDNNKIVDMDKKKNTEKHNA
DTKEQGEKNNADTKEQGEKNNADTKEQGEKNNADTKEQGEKNNADTKEQGEKNNADTKEQ
GEKNNADTKEQGEKNNVDKTKNIPYNNLHAQQTNNNYEEEKKINTNENLLKVQNFCLNYR
NSINHLIFYIKSKVFQRFRNLLERDGYTEIFTSKFIKIKESEKNPSVDKSEKNPSVDKSE
KNPSVDKSEKNPSVDKSEKNPSVDKSEKNYEETQDNNLENTSSSDNNINVQLTGSEGGCR
CYKLEGQNIVLSQSPQLFKQMLINSDFDKVYEINYCYRNEKFHSSRHLNEFMSLDIEKVI
YDNYYEIIIYMYNILKDMNTYINNNYFNELNILSSFYNNNNNYTYRASQFCDNPIVISFS
EAQDILDKYYRNNKNDILLLQKKENNIHINNKNTYIYDKKYNKYIKILNNEEKQNMKKKI
MFESSQKDKLHNIYYYNKILKYYKINKQENKQKKKNLFICSPHDMDKQYNEANIYNDAYY
HFLNTFNKDEFYRKILLFFNNMYDKYDMEKKKLQENNTNVLKTQTQIIDGSNIYRKVTYD
GNDDDNNNHDEHIKTLYDLINIINKKETNNDNINNNDDGNNNNNDDDGNVFITEPLSYNN
LKNKYILYDDFTNDELNYLYLFIKNNFQSDIFIIDQYPIFLRPYYTGSNMYDLRFSNSYD
FIYKGMEIISGSQRIHNLPILLFKTLKENKQISLSTYLHKKDNFTILNYLDNFQKLINKK
STIYKYFNSFQYASKPHGGLALGMERYLITLLNLNNVKNVTFSE
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgttgtgaaatatatatttttgatttgctatataaatacattatttttaaga
agagttttattttgctattcatataatttatcacaacatttttctttatacaataattca
aagtttgtgttattcaaaagaaataaaaaaagaaacaaaataaataaatatcataatatt
tattatcataagggtggttttcattatgaaaataatatcgggaataataatataagtaat
ccattttttttaaataagtttatatataataagaagaagcataaattgaatttttttaat
agtcctacttcttcttatgatgatgcgtgtattttaaaaaatctttttaattcctttaca
acagagggaagaataaaaaataaaaagagtgataaaaatgttaaaatgaatgttatgata
aaaaaaaaatgtatgctttatttaacgtttaataggaaagaaaatgataacatcattaat
aataataataatgataataataataataatgataataataataataatgataataataat
aataatgataataataattatcacgttgatgagtcgtatttatccaacataggagaacca
tgtatattactacgttcaacaagctggggacacctttctcttttttatggttcacattta
aatagagattattatacttatgaggatattataaaatatatagaaacaaatgaaaagaag
tttgtaaagtgtataaacaataatatatataataataatgataataataatacagatata
acaaaacaaacatttatcgataaaaagtacatacttattaggggtcgtatggaaagaaaa
aaaaaacaatccaaacgaattttcttatatctaagattaagtaatggaatgtacttaaca
tgtgtatatgaaaaaaaaatacccacaaataaaaataatcaatctatatattcaatagat
aatatgtatacctatataaagaatttaaaaaatgaaagtgttatagatgttgtaggaagg
atcaaattacatggaaccttatataaacacaacatatcttatatagaaagcttgcttaat
caaacagttatcgaattagtagcagaacaaataaattgtatttcagaatcgttttataat
cctccatttatgataaacgataatgatgtccacacaaaaaaaattcaaatggttataagg
ggagataataacaaaattgttgatatggataaaaagaaaaacactgaaaaacataatgct
gatacaaaagaacagggcgaaaaaaataatgctgatacaaaagaacagggcgaaaaaaat
aatgctgatacaaaagaacagggcgaaaaaaataatgctgatacaaaagaacagggcgaa
aaaaataatgctgatacaaaagaacagggcgaaaaaaataatgctgatacaaaagaacag
ggcgaaaaaaataatgctgatacaaaagaacagggcgaaaaaaataatgttgacaaaacg
aaaaacataccatacaacaatttacatgcacaacaaaccaataacaattatgaagaagaa
aaaaaaataaacacaaacgaaaacttgctgaaagtacaaaatttttgcttaaactataga
aattcaataaatcatttaattttttatattaaaagtaaagtatttcaaagatttagaaac
ctcttagaaagggatggctatacagaaatattcacatctaaatttataaaaattaaagaa
tctgaaaagaatccatctgttgataaatctgaaaagaatccatctgttgataaatctgaa
aagaatccatctgttgacaaatctgaaaagaatccatctgttgacaaatctgaaaagaat
ccatctgttgacaaatctgaaaagaattatgaagaaactcaagataataatttagagaat
actagttcatcagataataatataaatgttcaattaacaggatcggaaggtggttgtaga
tgttataagcttgagggacaaaatattgtgttatcacaaagtccacaattatttaaacaa
atgttaataaattctgattttgataaagtatatgaaattaattattgttatagaaatgaa
aaatttcatagttcaaggcatttaaatgaatttatgtctttagatattgaaaaagtaatc
tatgataattattatgaaattattatatatatgtataatatcttaaaagatatgaataca
tatataaataataactattttaatgaattaaatattttatcatctttttataataataat
aataattatacatatcgagctagccaattttgtgataatcccatagtcatctctttttct
gaagctcaagatatattagataaatattatagaaataataaaaatgatatattattatta
caaaaaaaagaaaacaatatacatataaataacaaaaatacatatatttatgataagaaa
tataataaatatataaaaatattaaataatgaagaaaaacaaaatatgaagaaaaaaatt
atgtttgaatcatctcagaaggataaattacataatatatattattacaacaaaatatta
aaatattataaaataaataaacaagaaaacaaacaaaaaaaaaaaaatctatttatatgc
tcacctcatgatatggacaagcaatataatgaagcgaacatatataatgatgcatattac
cactttttaaatacttttaataaagatgaattttatagaaagatattattattttttaat
aacatgtatgataagtatgatatggagaaaaagaaattacaagaaaataatacgaatgtc
ttaaaaacacaaactcagataatagatggatcgaatatatatcgaaaggttacttatgat
ggaaatgatgatgataataataatcacgatgagcatattaaaacgttgtacgatttaata
aatattataaataaaaaagaaacaaataatgataatattaataataacgatgatggtaat
aataataataatgatgatgatggtaatgtgttcattacagaacctttatcatataacaat
ttaaaaaataaatatattttatatgatgatttcacaaacgatgaattaaattatctatat
ttatttataaaaaacaattttcagagtgatatatttattatagaccaatatccaattttt
ttaagaccttattatacaggtagcaatatgtatgatctacgattttctaatagttatgat
tttatatataaaggtatggaaataatttctggaagtcaaagaattcataacctaccaatt
ttactttttaaaacattaaaagaaaataaacaaatatccttatcaacatatcttcataaa
aaggataatttcaccatattaaattatcttgataatttccaaaaattaataaataaaaaa
tcaacaatttataaatattttaattcttttcaatatgcttcaaaaccacatggaggatta
gctttagggatggaaagatatcttatcactctcttaaatcttaacaatgtaaaaaatgtt
actttttcggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system