KEGG   Plasmodium falciparum HB3: PFHG_00406Help
Entry
PFHG_00406        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PFHG_00406
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PFHG_00406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Structure
PDB: 

Jmol
AA seq 440 aa AA seqDB search
MESKICDPIGLDKNKFRKVEEENEENSKIVENGQMTYNDDLEMFTTIQLNQEIDIRKNPF
PLHMINQKNDIPLCAQEFSKLTDPLYIKKICLEKVHDWSRCNEDDVCVNQILSGLTNQLF
EVSIKEDTAIEYRITRRHVLFRIYGKDVDALYNPLSEFEVYKTMSKYRIAPLLLNTFDGG
RIEEWLYGDPLSIDDLKNKSILVGIANVLGKFHTLSRKRHLPEHWDKTPCVFKMMDRWRL
AVSNYKNLDKVTLDINKYIQESHKFLKFIKIYTQIENIANDIVFCHNDLQENNIMNTNKC
LRLIDFEYSGYNFLSADIANFFIETTIDYSYNAYPFFIINKKNYISYESRILFVTTYLSK
YLDDSTAASDQDIIDQFLEAIEVQALGLHLIWAFWSIIRGYQTKSYNEFDFFLYAKERLK
MYDEQKQYLMSKNIIKDYDD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaaatctgtgaccccattgggctcgataaaaataagtttcgtaaagtagaa
gaggaaaatgaggagaatagtaaaatagtagaaaatgggcaaatgacatataatgacgat
ttagaaatgttcacaacaatacaacttaatcaagaaatagatatacgtaagaaccctttt
ccattacatatgataaatcaaaagaatgatatacctttatgtgctcaagaattttcaaaa
ttaacagatcctttatatattaaaaaaatatgtcttgaaaaagtacatgattggtctagg
tgtaatgaagatgatgtatgtgtaaatcaaattttaagtggattaactaatcaacttttt
gaagttagtataaaagaagacacagcaattgaatatagaataacgagaagacatgtttta
tttagaatatatggaaaagatgtagatgcattatataatcctttaagtgaatttgaagta
tataaaacaatgagtaaatatagaatagcacctttattattaaatacatttgatggtggg
cgtatcgaggaatggttatatggagatcctctaagtattgatgatttaaaaaataaatct
atattagttggaatagccaatgtattaggaaaatttcatacacttagtcgaaaacgtcat
ttacctgaacactgggataaaactccttgtgtatttaaaatgatggataggtggagatta
gctgtatcgaattataaaaatcttgataaagtaaccttagatattaataaatatatacaa
gaatctcataaattcttaaaatttattaaaatatatacacaaatagaaaatatagcaaat
gatatcgttttttgtcataatgatttacaagaaaataatataatgaatacaaataaatgt
ttaagattaatcgattttgaatattcaggatataatttcctatcggcagatatagcaaac
ttctttatagaaacaacaatcgattattcatataacgcatatccattttttattattaat
aaaaaaaattacatctcatatgaatcaagaatactttttgtaacgacttatctatccaaa
tatctagatgattcaacagctgcttcggatcaagatatcatagaccaattcctagaagcc
atagaagtacaagctttaggtttacatctaatatgggcattctggtctatcataagagga
taccaaacaaaaagttataatgaatttgatttcttcttatatgcaaaggaaagacttaaa
atgtatgatgaacaaaaacaatatttaatgtccaaaaatattatcaaggattatgacgat
taa

DBGET integrated database retrieval system