KEGG   Plasmodium falciparum HB3: PFHG_00506Help
Entry
PFHG_00506        CDS       T01052                                 

Definition
mitogen-activated protein kinase 1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pfh  Plasmodium falciparum HB3
Brite
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PFHG_00506
Protein kinases [BR:pfh01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PFHG_00506
Exosome [BR:pfh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PFHG_00506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 914 aa AA seqDB search
MPKEDCKTEKSIDSIDENVLKKYDILKKVGKGAYGVVFKGRCKKNKNIVAVKKIFGAFQN
CTDAQRTFREIIFLYELNGHDNIIKLMDVIKAKNDNDIYLIFDFMETDLHEVIKADLLEE
IHKKYIIYQLLRALKYIHSGGLLHRDIKPSNILVNSECHIKVADFGLARSISTHVNENKV
PILTDYVATRWYRAPEILLGSTHYTEDVDMWSLGCIMGELLCGKPLFTGNSTMNQLEKII
QVIGKPNKKDIEDIRSPFAEKIISSFVDLKKKNLKDICYKASNESLDLLEKLLQFNPSKR
ISAENALKHKYVEEFHSIIDEPTCRHIITIPINDNTKYRVNFYRNVVYFVIMRRNKFHSN
VLNQGESKKEEKKDRYYRRDKDKKKCICENNKVHMEDKEYKNKIIFSQGDKPEDIKEDHK
KCKICDEIHVDTSKQIDSINLEHVVLNNNDVSYVDKKKKTKYEPVYKERGKMKKDKMGNV
YCKDRERRVFYEARKKESITNFTTATTISKSDDTEVEMSQMEINEIESNEMKGKIKEQIK
EQIKEQIKEQIKEQIKKTQNNISKISIGSNTMSSTISKTEPNSRNYFINKKSVESFYTKE
RKNNDILFHANNKKVIFFKDKNKIKNHSSEKKKIKYKVFYGFKKSYENEQNVPHYLETKC
SNSPLGKNYYYKKYVDGSNKKYVDGGNKKYVDGGNKKYVDGSNKKYVDGSSKKYVDGGNK
KYVDGSSKKYVDGGNKKYVDGSSKKYVDEGNKKYVDGGNKKYVDGGNKKYVDGRDKKYNH
NYNHFNNNYYYYSRRGSLKSVNKEEENCSQRTWKNTAKLHLPLVVNKSTKPLNTLSHDYY
NKDEENKYMNNSMLKKEVKKKIWRHLIDNENKKNQDMTDYYYNPIINKTEKNNKRINFKC
GEKKKTEEKCVSNE
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagaagattgcaagacagaaaagagtatagacagtattgatgagaatgtatta
aaaaaatatgatatattaaaaaaagttggtaaaggagcttatggtgttgtatttaaaggt
agatgtaagaaaaataagaacattgtagctgtgaagaaaatatttggagcttttcaaaat
tgtacagatgctcaaagaacgtttagagaaataatatttttatatgaattaaatggacat
gataatataataaaattaatggatgttataaaagcaaagaatgataatgatatatatctt
atttttgatttcatggaaaccgatttacatgaagtaataaaagcagatttattagaagag
atccataagaaatatataatatatcaattattaagagctttaaaatatatccattcagga
ggtttattacatagagatattaaaccatcaaatatattagtaaattcagaatgtcatata
aaagtagcagactttggattagctagaagtatttcaactcatgttaatgaaaataaagta
cctatactaacagattatgtagcaactcgatggtatagagctcctgaaattttgttgggt
agtacgcattatacagaagatgttgatatgtggtccttaggttgtatcatgggagaatta
ttatgtggaaaaccgttatttacaggaaattctacaatgaatcaattagaaaaaataata
caagtaataggaaaaccgaataaaaaggatatagaagatattagatcaccttttgccgaa
aaaataatttcgtcttttgtagatttaaaaaaaaaaaatttaaaagatatatgttataag
gcttctaacgaatccttagatttattagaaaagttgttacagtttaatccgtctaaaagg
ataagtgcagaaaatgcccttaaacataaatatgttgaagaatttcattcaataattgac
gaacctacatgtagacacattattacaattcccataaatgataatacgaaatatagagtt
aatttttataggaatgttgtttattttgtaattatgcgtaggaataagtttcactctaat
gtattgaaccaaggggaaagtaaaaaagaagaaaagaaggatcgatattatagaagggat
aaggataaaaaaaaatgtatatgtgaaaataataaagtacatatggaagataaagaatat
aagaataagatcatattttctcaaggggataaacctgaagacataaaggaagaccacaaa
aaatgtaaaatttgtgatgaaattcatgtggatacatcaaaacaaattgattctatcaac
ctagagcatgtagttcttaataacaatgatgtatcttatgttgataagaaaaaaaaaaca
aaatatgaaccagtatacaaggaaagaggaaaaatgaaaaaagataaaatgggaaatgtt
tactgtaaggatagagaaaggagagttttttacgaggctagaaaaaaggagagcattaca
aattttacgacagcaacgacgattagtaaaagtgatgatacagaagtggagatgagtcag
atggaaataaatgaaattgagtcaaatgaaatgaaaggaaaaataaaagaacaaataaaa
gaacaaataaaagaacaaataaaagaacaaataaaagaacaaattaagaagactcaaaat
aatattagtaagatttccatagggagtaatacaatgagtagcactatcagtaaaactgaa
cctaatagtagaaactattttattaataagaaaagtgttgaatctttttatactaaagaa
agaaaaaataatgacatattgtttcatgctaataataagaaggttatattttttaaagac
aaaaataagattaaaaatcatagctcagaaaaaaaaaaaattaaatataaagtattttat
ggttttaaaaaatcatatgaaaatgaacaaaatgtacctcattatttagaaaccaaatgt
agtaatagcccgttagggaagaattattattataaaaaatatgtggatggaagtaacaaa
aaatatgtggatggaggtaacaaaaaatatgtggatggaggtaacaaaaaatatgtggat
ggaagtaacaaaaaatatgtggacggaagtagtaaaaaatatgtggatggaggtaacaaa
aaatatgtggacggaagtagtaaaaaatatgtggatggaggtaacaaaaaatatgtggac
ggaagtagtaaaaaatatgtggatgaaggtaacaaaaaatatgtggatggaggtaacaaa
aaatatgtggatggaggtaacaaaaaatatgtggatggacgtgataaaaaatataaccat
aattataaccattttaataataattactattactatagtcgtagaggctctttgaaaagc
gtaaacaaagaagaagagaactgttcccaaagaacatggaagaatacagcaaaattacat
ttaccccttgtagtaaataaaagcacaaaaccattgaatactttatcacacgattattat
aataaagacgaagaaaataaatatatgaataatagtatgttaaaaaaagaagtgaagaaa
aaaatatggagacatctcatagataatgagaataaaaaaaatcaagatatgacagattat
tattataatcctataataaataagacagaaaagaataataagaggataaattttaaatgt
ggtgagaaaaaaaaaacagaggagaaatgtgtttcaaatgagtaa

DBGET integrated database retrieval system