KEGG   Plasmodium falciparum HB3: PFHG_00631Help
Entry
PFHG_00631        CDS       T01052                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFHG_00631
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFHG_00631
   00620 Pyruvate metabolism
    PFHG_00631
   00640 Propanoate metabolism
    PFHG_00631
Enzymes [BR:pfh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PFHG_00631
Lipid biosynthesis proteins [BR:pfh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PFHG_00631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 972 aa AA seqDB search
MNNLKSYGSLSKVDSVQINGMDIDTNIFLNMNSYPTKEIYDDENNKNDGNHNIKNFQAYK
AMYEESINNPEAFWGNLAKNNLIWYKLFTKVFLGNFKKGNINWFVNGKINACENCVDRWV
EKDPNKIALIWEQDCPDQYKKITYQKLLEKTCKVANLLKLIGVKKQDTVTIYLPMIPELV
YSMLACVRIGAIHNVVFAGYSAASLSDRIIDSRSTVLITSDFGLRGGKLTKLKQIADVAM
DMCGMIQTCIVFKNKTKMKDKNIQIKTPMENPIYNFTSFDSNSPQNFTINNSNDFIQIKS
THSHQSDHQNDFSLQQEDNNYAKNSNMSYTTSMYYHDNNLNHINTNKNNDHYNNNLNNKN
YLNNNINDQSPMYVHTMNHNDNNDDNNNNNNNVDDDNNSNIQNDEQSYFNQQNNTYNKND
HSDDNNKNKGKTTLHKKITKNNPINHKISYSEKSYSKELINTDMVNNDNQFGDLKTKKKF
ININNIITCNQNGYSTNKQYFPEPDKNSTSNFDETLCVLKKGRDIDGTALLKNMRSYCPI
EYVDSEDFLFLLYTSGSTGKPKGVAHTTAGYLLYAYTTCKYIFDVKENDIFGCVADIGWV
TGHTYVLYGPLLNGITTVIFSSIPTYPDCGRYWSLIQTHKVTQFYTAPTALRALMKYGDE
WIQKYDLSSCRILGSVGEPINPETWRWYYNVVGKKKCTIVDTYWQTETGGIVIAPIPHLF
SMKPGCASLPFLGVQLEILDSKTLQPLSGNNVCGLLCIKSPWPGMLRTMERSEMKMDTIG
YLGRIDDTLNVAGHRLGAAEIEHALVQHFYIAEAAVVSFHHNVKGEGILCFVVKKKGDIK
NYSKGITDIVNSNNNNNRNELHNNSPFLICSNNITDIEEFKKNFTDEKLIEQLKLYVRQV
IGPIATPDLICVVPDLPKTRSGKIVRRILRCIANGITDFGDISTVSNYEVIETINNTLNE
CKKKLKHIEIKK
NT seq 2989 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgaagagttatggaagtctatcaaaagtcgactctgttcaaatcaacggt
atggatatagatacaaatatttttcttaatatgaattcttaccctaccaaggaaatatat
gatgatgagaataataagaatgatggaaatcataacataaaaaatttccaagcatataaa
gcaatgtatgaagagagtataaataatccagaagctttttggggaaatttagcaaagaat
aatttaatatggtataaattatttactaaagtatttttaggtaattttaaaaaaggaaat
ataaattggtttgttaatgggaaaattaatgcttgtgaaaattgtgttgatagatgggtt
gaaaaagatcctaataaaattgcacttatatgggaacaagattgtccagatcaatataaa
aagattacatatcagaaattattagaaaagacttgtaaagtagctaatttattaaaactt
attggtgttaaaaaacaagacactgttactatttatttacctatgatacctgaattggtt
tattctatgctagcttgtgttcgtattggagctattcataatgtagttttcgctggttat
tcggcagctagcttgagcgatagaataatagattctagatctactgttttaattacttct
gattttggattgagaggtgggaaattaaccaaattaaaacaaattgctgatgtagctatg
gatatgtgtggaatgatacaaacatgcatagtattcaaaaataaaactaaaatgaaagat
aaaaatatacaaattaaaacacctatggaaaatcctatttataattttacaagttttgat
tctaatagtccacaaaattttacaattaataattctaatgattttattcaaataaaatca
actcattcccatcaaagtgatcatcaaaatgatttctctcttcagcaggaagataataat
tatgcaaaaaactctaatatgtcttatactacgagtatgtattatcatgataataattta
aaccatataaacactaataaaaataacgatcattataacaataatttaaataataaaaat
tatttaaataataatattaatgatcaaagccctatgtatgttcataccatgaaccataat
gacaataatgatgataataataataataataacaatgtagatgatgataataatagtaat
atacaaaatgatgaacaatcttattttaatcaacaaaataatacatataacaaaaatgat
cattctgatgacaataataagaataaaggaaaaacaaccttacataaaaaaattacaaaa
aataatcctataaatcataaaatttcttactcagaaaaaagttactcaaaagaattaata
aacactgacatggtaaataacgataatcaatttggtgatttaaaaacaaaaaaaaaattt
ataaatattaataatattataacttgtaatcagaatggatattctacaaataaacaatat
tttcctgaacctgataaaaatagcacaagcaattttgatgaaactttatgtgttttaaaa
aaaggaagagatatagatggtactgctttattaaaaaatatgagatcttactgtcctata
gaatatgtagatagtgaagatttcttatttttattatatacatctggatcaactggtaaa
cctaaaggtgttgcacatacaacagctggatatttattatatgcatatacaacatgtaaa
tatatatttgatgtaaaagaaaatgatatatttggttgtgtagcagatataggttgggtt
accggacatacatatgtattgtatggtcctttattaaatggtataactacagttattttt
tcttctataccaacatatccagattgtggtagatactggagtctaatacaaacacataaa
gtgacacaattttatacggctccgacagccttaagagcattaatgaaatatggagatgaa
tggatacaaaaatatgatctatcttcatgtcgtattttgggaagtgtgggtgaaccaatc
aatccagaaacatggagatggtattataatgtagtaggtaaaaaaaaatgtacaatagta
gatacatattggcaaacagaaacaggtggtatcgttatagcacctataccacatttattc
agtatgaaaccaggatgtgctagtttaccattcttaggtgttcaattagaaatattagat
tcaaaaactttacaacctttaagtggtaataatgtatgtggtttattatgtataaagagc
ccatggccaggaatgttacgtacagtatatggaaatcatcaaagattaataaaaacatat
tttaccatgtgtcctaattattattttaccggagatggagcgttcagagatgaagatgga
tactattggatatctcggacgaatcgatgatacattaaatgtagcagggcacagattagg
agcagcagaaattgaacatgcactagttcaacatttttatattgctgaagcagctgttgt
ttcatttcatcataatgttaagggagaaggaattttatgttttgtcgttaaaaaaaaagg
agacataaaaaattatagtaaaggtattacagatattgttaatagtaataataacaataa
tagaaatgaattacataataatagtccatttttgatatgctctaataatattactgatat
tgaagaatttaaaaaaaattttaccgatgaaaaattaatagaacaactaaaattatatgt
aagacaagttattggacccatagcaacacctgacctaatttgtgtggttccagatttgcc
aaaaaccagaagtggaaaaattgttagaagaatattaagatgtatagcaaatggtataac
agatttcggagatatttccactgtctcgaattatgaagttattgaaactattaataatac
acttaatgaatgtaaaaaaaagttaaagcatattgaaattaagaaataa

DBGET integrated database retrieval system