KEGG   Plasmodium falciparum HB3: PFHG_00728Help
Entry
PFHG_00728        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PFHG_00728
Enzymes [BR:pfh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PFHG_00728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 1204 aa AA seqDB search
MKSMTLYHENFKNINSFLNSASVIWIEKEKLDSIIYIPLYTDIFQYVENFIKNTEKKEKK
NVLTKIYLLFDDDTYNIAVDISPLCNEHTNRIPLLIYESYHFWHLQFLFEKFKIKRQKLI
LNPFENLKDIINKNRTYDYVYMYTSIYNCANNNFERQSKGEKIIQNHNEEITQEINQKVI
TKYCTYRNNFSTHLSLLNYNFKDNNNLYNDSNIKNKEPNWCPLKINIENIQKKRFKKINK
NKKHKNSKILNNTNMVHTLNSYVIPSNHFEKDDTKNKNLCIISQKEGNLHFQPYNGELKK
MKPLVYEEYEIISTDNDSNTLECGKKHENYNTSYDNYMYCTTNRCGRSPRYEGSKKSYAE
NNSRVYNRPHRKRKEKKKKWYYYEDSSSNDKNYNNNKKDDEEEEEEEENNDDKEENNDDK
EENNDDKEENNDDKEENNDDEEEENNNNNNNNNSNKCDSLLTLDESFNNKKRKTSTCSTY
SYNHMKKYKVEELKTDECNYDENYYNNTNNNNCYPLKEIYNYKYSEQMCNKFKKERIHTY
DTFENKKGEKKNSVKNRKILHSSILSLDSQKMNPFDPIHTFKNMFCKSEKENLDFNHSDM
FHIYHHNDSMDKYVNKILKNIMNKEKSPLNCLSKNYQRIEALYNKKYKIFLMDNKQIING
KTHFKNNKNEYILSKYEKEMGLYELFKKYIKRDVEKVHNEKGQPQKPSNQNIERIHNSTE
KHILQIQKRQEHSCVTEIVGMCNIKEQDIINVKSCDDDDIICLSDEKNYMQEENDVICID
DNNNNNIYNDNNYNDNNYNDNIYNNNIYNDNNYNDNIYNDNNIIDRHNNGGVLFYAYKKE
DTKVIKLKEGDSLYIKFFNSSDDYDKVKILKQETILFILIYIMQNKETPTLSDICIFSPD
LFWNICLYFKDNIMGVDPSLVKIHKFLSTGKSEENGYHRYSSKRINYCEKRKKRKNREPM
EIMKLKDNVEFLDKFLENVNERKLNKLKEIQSQNFEKYELHRNINSLNKQQLINLFIDKE
YQINLIPLTLLKEKSRNIIYEENIKMNMCACIRVIFDSIKGRCIYAASNMYKLDFICEYV
GDLLTYNEAMKREEKYKRNTKKGCFMFYFKYDNKTYCVDSTKESMVDAEIHNKKMKKKKI
LRSFARLVNHSKKKSNLIPKVLKVENNPRLFFVASRDIKEGEELLIDYGERDKDIIKDNE
WLKF
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatgacattataccatgaaaattttaagaatattaattcatttttaaattct
gcttcagttatatggattgaaaaggaaaaacttgattcaattatttatatccctctatat
acggatatatttcaatatgttgaaaatttcataaaaaatacagaaaaaaaagaaaaaaaa
aatgtcctcacgaaaatttatttgctttttgatgatgatacttataatatagcagtggac
atatcggtataaaaaaaaaaaaaataaatatatatatatatatatttatttatttattta
tttatgtgtgtgtgtaatttattttgtgtggtcaagttatacctcatatattatttttta
tattattttttatattattttttattttatttttttttttttttgtcatttccttgtttt
ttttagcccctgtgtaatgagcacacgaatagaataccacttttaatttatgagtcatat
catttttggcacttacagtttctttttgaaaaattcaagataaaaagacaaaagctaatt
ttgaatcctttcgagaatttaaaagatatcataaataaaaatcgaacatatgattatgta
tatatgtacacatctatttataattgtgcaaataataatttcgaaagacaaagtaaaggt
gaaaagatcatacaaaatcataatgaagaaataacacaagaaataaatcaaaaagtcatt
acaaaatattgcacgtataggaataatttttctacacatttatctttactaaattataat
tttaaagataataataatttatacaatgatagtaatataaaaaataaggaaccaaattgg
tgtccattaaaaattaacattgaaaatattcaaaaaaaaaggtttaaaaaaataaacaaa
aataagaaacataaaaatagtaaaatattaaataataccaatatggtacacacattaaat
tcatatgttattccttctaatcattttgaaaaggacgatactaaaaataaaaatttatgc
attatatcacaaaaagaaggaaaccttcattttcaaccatataacggagaattaaaaaaa
atgaaacctttggtatatgaagaatatgaaataattagtactgacaatgattctaataca
cttgaatgtggtaaaaaacatgaaaattataatacatcttatgataactatatgtattgt
actactaataggtgtggtagatcacccagatatgaaggttctaagaaaagttatgctgag
aataattctagggtgtataataggcctcatagaaaaagaaaagagaagaaaaaaaaatgg
tactattatgaagatagtagtagtaatgataaaaattataataataataaaaaggatgat
gaggaggaggaggaggaggaggaaaataatgatgataaggaggaaaataatgatgataag
gaggaaaataatgatgataaggaggaaaataatgatgataaggaggaaaataatgatgat
gaggaggaggaaaataataataataataataataataatagtaataaatgtgatagtctt
cttactttggatgaatcctttaacaataaaaaaagaaaaactagcacatgctctacttat
agctataatcatatgaagaaatacaaagtggaagagttaaaaactgatgaatgtaattat
gatgagaattattataataatactaataataataattgttatcctcttaaggaaatatac
aactataaatactctgaacaaatgtgtaataaattcaaaaaggaacgtattcatacttat
gacacattcgaaaataaaaaaggagaaaaaaaaaattctgttaagaatcgcaagatctta
cattcctcaatcctttcattagatagtcaaaaaatgaatccatttgatcctatacataca
tttaaaaatatgttttgcaaaagtgaaaaagaaaatctagatttcaatcatagtgatatg
tttcatatttatcatcataatgatagtatggataaatatgtaaataaaattctgaagaat
attatgaacaaagaaaaatctcctttaaattgtttatctaaaaattatcaaagaatagaa
gcactatataataaaaaatataaaatatttttaatggataataaacaaattataaatggc
aaaacacattttaaaaataataaaaatgaatatattttaagtaagtatgaaaaagaaatg
ggactctatgaactctttaaaaaatatattaaaagagatgtagaaaaagttcataatgaa
aaggggcagcctcaaaaaccttctaatcaaaacatagaaaggattcataattctacagag
aaacacattctacaaattcaaaaaagacaagagcattcttgtgtaaccgaaatagttgga
atgtgcaatataaaagaacaagatataataaatgttaaaagttgcgatgacgatgatatt
atatgtttatctgatgaaaaaaattatatgcaagaagaaaatgatgtaatatgtattgat
gataataataacaacaatatttataatgacaataattataatgacaataattataatgac
aacatttataataacaacatttataatgacaataattataatgacaatatttataatgac
aataatattattgaccgccacaacaatggaggtgtattattttatgcttataaaaaagaa
gatacaaaagtcataaaactgaaggaaggagatagcttatatataaaattcttcaacagt
tctgatgactatgataaggtaaaaatattaaaacaagaaaccattttgtttattttgata
tatataatgcaaaataaagaaacgccgactttatcagatatatgtattttttcaccggac
cttttttggaacatctgcttatattttaaagataatattatgggggttgatcctagttta
gtaaagatacataaatttttgtcaacaggtaaaagtgaagaaaatggttatcatagatat
tcatctaaacgaataaattactgcgaaaaaagaaaaaaaagaaaaaatagagaaccaatg
gaaattatgaaattaaaggataatgtagaatttctagataaatttcttgaaaacgtaaat
gaaaggaaattgaataaattaaaagaaattcaatcccagaactttgaaaaatatgaatta
catagaaatattaatagcctaaataaacaacaactgattaacttatttatagataaagaa
tatcaaattaatcttattccattaacacttttaaaagaaaaatctagaaatattatatat
gaagaaaatatcaaaatgaatatgtgtgcatgtatacgagttatttttgatagtataaaa
ggaagatgtatatatgccgccagcaatatgtataaactcgattttatttgcgaatatgtt
ggagatctgttgacatataatgaagctatgaaaagagaagaaaaatataaaagaaataca
aaaaaaggatgttttatgttttactttaaatatgataataaaacatactgtgttgatagt
accaaagaaagtatggtagatgcagaaattcataataagaagatgaaaaaaaaaaaaatt
ctcagatcatttgctaggttagtaaatcattcaaaaaaaaaatctaatttaattccaaaa
gttttgaaagttgaaaataatcctaggctgtttttcgttgcttcacgtgatataaaagaa
ggagaagaattgcttattgattatggagaaagggacaaggatataataaaagataacgaa
tggttaaaattttaa

DBGET integrated database retrieval system