KEGG   Plasmodium falciparum HB3: PFHG_01361Help
Entry
PFHG_01361        CDS       T01052                                 

Definition
NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pfh  Plasmodium falciparum HB3
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 764 aa AA seqDB search
MVVSFWLFYRSENFNLLRRLISKLRSLFPLFIKNNFLNNEIKNSVKIYFGSQSGTAEEFA
KELKANLNDLFHIQANIIDLEYFNKEEIKSFGIRIFIVATYGDGEPTDNAVEFFKWLKSL
NNDNDYFRNTKYSIMGLGSKQYKHFNKIAKKLDTFLLNFKAHQISETIYGDDDDNIYHDF
EVWKNKFFMQLPKLLNMKNIPIYVPKEDIIELTSWRDMAEIKLDIQYYDHLIEEDNKKEK
NVVTENIINESVTNNQQLLNHNQNNLSINNKSNYISTDIIGKFYFNHLTGKVISNTKLLK
NVDLSNNGDKVNHINISIEDNIIYKAADNLSILTKNTKEVITWWLKRLNIDEKEKTKKFT
FVKRNKLIDNSFTMNDPKDDVKNETFNNDVNKGNNKTNIDYNSNNNGNNNNNNNYNEYDD
NHIYVPFPTPCSVEDALSYYCDLTTIPRLNILKKFKCFIKDIEELKMFNFILSNNQRNTF
FNICKECDMTFIEFVDMFMQSAVFELSPFLQLIPRNTPKSYTISSSPKESKDILSLTVKK
KQYCIHSLRRALKNLKTNDMFPKLNEQKLRELCSRRWFKGSSSYYLTEELNVNDIVKFNI
KPSKFVLPENIQSSHIIMIATGAGIAPFKAFLSEFIYYDQQIVKDNFVRKGKRILFYGCR
KREVDFLYEMEIMDALDKKHIDETYFAFSRDQESKIYVQDLILQKKELVWNLLQKGAYIY
VCGNSNMSKDVNKTINSLPLHFKQNDKKFTKKLKKSGRYIYEIW
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggtagtttccttttggttattctatagatcagagaatttcaatttattgagaagatta
attagcaagctaagaagtttgttccctctttttataaaaaacaactttttaaataatgaa
attaagaatagtgtaaaaatatattttggtagtcagagtgggacagcagaagaatttgcc
aaagaattaaaagcgaacttgaatgatttatttcatatacaagcaaatattatcgattta
gaatattttaataaagaagaaataaaatcttttggaatccgtatatttattgttgcaacg
tatggagatggagaaccaacggataatgcagttgaattttttaaatggttaaaaagttta
aataatgataatgattattttagaaatactaaatattccattatgggtttaggtagcaaa
caatataaacattttaataagatagctaaaaaacttgatacatttcttttaaattttaaa
gctcatcaaattagtgaaactatttatggtgatgatgatgataatatatatcatgatttt
gaagtatggaaaaataaattttttatgcaacttccaaaattattaaatatgaaaaatata
cctatttatgtacccaaagaagatattattgaattgacatcttggagagacatggcagaa
attaagttagatatacaatattatgatcatttaatagaagaagataataaaaaagaaaaa
aatgtagtaacagaaaatattataaatgaaagtgttacaaataatcagcaattattgaat
cataaccaaaacaatttaagtattaataacaaatcaaattatataagtacagatataata
gggaaattttattttaatcatcttacaggaaaagttatttccaatacaaaattattaaaa
aatgtggatttatcgaataacggagataaagttaatcatatcaatattagcattgaggat
aatattatttataaagctgcagataatttatctattttaacaaaaaatacaaaagaggtc
attacctggtggttaaaacgattaaacatagatgaaaaagagaaaacaaaaaaattcacc
tttgtaaaaagaaataaattaatagataattcatttactatgaatgatccaaaggatgat
gtaaaaaatgaaacatttaacaatgatgttaataaagggaataataaaacaaatattgat
tataatagtaacaataatggtaataataataataataataattataatgaatatgatgat
aatcatatatatgtaccctttccaacaccatgtagtgttgaagatgcattatcatattat
tgtgatctaacaactattccaagattgaatattttaaaaaagtttaaatgttttattaaa
gatatagaagaacttaaaatgtttaactttattttatctaacaatcaaaggaatacattc
tttaacatatgtaaagaatgtgatatgacatttatagaatttgttgatatgttcatgcaa
agtgctgtatttgaattatctccatttttacaattaatacctaggaatactcctaaaagt
tatacaatttcttcttctccaaaggaatcaaaagatatattatcattaactgttaagaag
aaacaatattgtatacattctcttagaagagcattaaaaaatttaaaaacaaatgatatg
tttccaaaattaaatgaacaaaagctacgagaactttgtagcagaagatggtttaaggga
tcatcctcatactatctaacagaagaattaaatgtaaatgatatagttaaattcaatata
aaaccttccaaatttgttctcccagaaaatattcaatcatctcatattattatgattgct
acaggtgcaggaattgcaccttttaaagctttcctgagcgagtttatatattatgatcaa
caaattgtaaaagataattttgtaagaaaaggaaaaagaatattgttttatgggtgcaga
aaaagagaagtagacttcctctacgaaatggaaattatggatgctcttgacaagaaacat
attgatgaaacatactttgcattctcacgagatcaagaaagtaaaatatatgtccaagat
ttaattcttcagaaaaaggaacttgtatggaatttattacaaaagggtgcatatatttat
gtttgtggaaatagtaatatgagtaaagatgtaaacaaaaccattaatagtttgcctctc
cattttaaacaaaatgataaaaaatttacgaaaaagttgaaaaaatctgggcgttatatc
tatgagatatggtaa

DBGET integrated database retrieval system