KEGG   Plasmodium falciparum HB3: PFHG_01361Help
Entry
PFHG_01361        CDS       T01052                                 

Definition
NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pfh  Plasmodium falciparum HB3
Brite
Enzymes [BR:pfh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PFHG_01361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 764 aa AA seqDB search
MVVSFWLFYRSENFNLLRRLISKLRSLFPLFIKNNFLNNEIKNSVKIYFGSQSGTAEEFA
KELKANLNDLFHIQANIIDLEYFNKEEIKSFGIRIFIVATYGDGEPTDNAVEFFKWLKSL
NNDNDYFRNTKYSIMGLGSKQYKHFNKIAKKLDTFLLNFKAHQISETIYGDDDDNIYHDF
EVWKNKFFMQLPKLLNMKNIPIYVPKEDIIELTSWRDMAEIKLDIQYYDHLIEEDNKKEK
NVVTENIINESVTNNQQLLNHNQNNLSINNKSNYISTDIIGKFYFNHLTGKVISNTKLLK
NVDLSNNGDKVNHINISIEDNIIYKAADNLSILTKNTKEVITWWLKRLNIDEKEKTKKFT
FVKRNKLIDNSFTMNDPKDDVKNETFNNDVNKGNNKTNIDYNSNNNGNNNNNNNYNEYDD
NHIYVPFPTPCSVEDALSYYCDLTTIPRLNILKKFKCFIKDIEELKMFNFILSNNQRNTF
FNICKECDMTFIEFVDMFMQSAVFELSPFLQLIPRNTPKSYTISSSPKESKDILSLTVKK
KQYCIHSLRRALKNLKTNDMFPKLNEQKLRELCSRRWFKGSSSYYLTEELNVNDIVKFNI
KPSKFVLPENIQSSHIIMIATGAGIAPFKAFLSEFIYYDQQIVKDNFVRKGKRILFYGCR
KREVDFLYEMEIMDALDKKHIDETYFAFSRDQESKIYVQDLILQKKELVWNLLQKGAYIY
VCGNSNMSKDVNKTINSLPLHFKQNDKKFTKKLKKSGRYIYEIW
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggtagtttccttttggttattctatagatcagagaatttcaatttattgagaagatta
attagcaagctaagaagtttgttccctctttttataaaaaacaactttttaaataatgaa
attaagaatagtgtaaaaatatattttggtagtcagagtgggacagcagaagaatttgcc
aaagaattaaaagcgaacttgaatgatttatttcatatacaagcaaatattatcgattta
gaatattttaataaagaagaaataaaatcttttggaatccgtatatttattgttgcaacg
tatggagatggagaaccaacggataatgcagttgaattttttaaatggttaaaaagttta
aataatgataatgattattttagaaatactaaatattccattatgggtttaggtagcaaa
caatataaacattttaataagatagctaaaaaacttgatacatttcttttaaattttaaa
gctcatcaaattagtgaaactatttatggtgatgatgatgataatatatatcatgatttt
gaagtatggaaaaataaattttttatgcaacttccaaaattattaaatatgaaaaatata
cctatttatgtacccaaagaagatattattgaattgacatcttggagagacatggcagaa
attaagttagatatacaatattatgatcatttaatagaagaagataataaaaaagaaaaa
aatgtagtaacagaaaatattataaatgaaagtgttacaaataatcagcaattattgaat
cataaccaaaacaatttaagtattaataacaaatcaaattatataagtacagatataata
gggaaattttattttaatcatcttacaggaaaagttatttccaatacaaaattattaaaa
aatgtggatttatcgaataacggagataaagttaatcatatcaatattagcattgaggat
aatattatttataaagctgcagataatttatctattttaacaaaaaatacaaaagaggtc
attacctggtggttaaaacgattaaacatagatgaaaaagagaaaacaaaaaaattcacc
tttgtaaaaagaaataaattaatagataattcatttactatgaatgatccaaaggatgat
gtaaaaaatgaaacatttaacaatgatgttaataaagggaataataaaacaaatattgat
tataatagtaacaataatggtaataataataataataataattataatgaatatgatgat
aatcatatatatgtaccctttccaacaccatgtagtgttgaagatgcattatcatattat
tgtgatctaacaactattccaagattgaatattttaaaaaagtttaaatgttttattaaa
gatatagaagaacttaaaatgtttaactttattttatctaacaatcaaaggaatacattc
tttaacatatgtaaagaatgtgatatgacatttatagaatttgttgatatgttcatgcaa
agtgctgtatttgaattatctccatttttacaattaatacctaggaatactcctaaaagt
tatacaatttcttcttctccaaaggaatcaaaagatatattatcattaactgttaagaag
aaacaatattgtatacattctcttagaagagcattaaaaaatttaaaaacaaatgatatg
tttccaaaattaaatgaacaaaagctacgagaactttgtagcagaagatggtttaaggga
tcatcctcatactatctaacagaagaattaaatgtaaatgatatagttaaattcaatata
aaaccttccaaatttgttctcccagaaaatattcaatcatctcatattattatgattgct
acaggtgcaggaattgcaccttttaaagctttcctgagcgagtttatatattatgatcaa
caaattgtaaaagataattttgtaagaaaaggaaaaagaatattgttttatgggtgcaga
aaaagagaagtagacttcctctacgaaatggaaattatggatgctcttgacaagaaacat
attgatgaaacatactttgcattctcacgagatcaagaaagtaaaatatatgtccaagat
ttaattcttcagaaaaaggaacttgtatggaatttattacaaaagggtgcatatatttat
gtttgtggaaatagtaatatgagtaaagatgtaaacaaaaccattaatagtttgcctctc
cattttaaacaaaatgataaaaaatttacgaaaaagttgaaaaaatctgggcgttatatc
tatgagatatggtaa

DBGET integrated database retrieval system