KEGG   Plasmodium falciparum HB3: PFHG_01431Help
Entry
PFHG_01431        CDS       T01052                                 

Definition
hypothetical protein similar to pyrophosphate-dependent phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pfh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfh00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pfh00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfh00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pfh00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 1418 aa AA seqDB search
MDTKSGDKNAANKGGADGLVKTVSVLLRDNKCQFNIDENYDHNDKEKLECEVGKRDSGMI
NCLMEKLTSKKFLEEKESKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERTKYIP
SLPKALASEYQILDENYGDEFINKNDYEDVKRFLKNLHNLPMLNVKDSNNNESFKGGNIL
KIGIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTITDSMMNRF
RNLGGFNMLWSGRGKVKNKDDLIAIENIVAKLKLNGLVIIGGDGSNSNAALMAEYFAERQ
IPISIIGVPKTIDGDLKSEAIEISFGFDTATRTYSEIIGNLCTDVKTGHNVYHVVRVMGR
SASHVVLECALQTRPNVVLIGEEVEQLNLSLKDIVKNIVNIILKRKSLNKNYGVILLPEG
LIEFVPEMKILISELNVILKDGPFDASKLQKSKEVWDFLPPIIRDQLLMDRESTGYIQVG
KIATERLIIVLVESELAKLNDKNLNIQFMSHYLGYEGRCAIPSNFDCNYCYALGYNAALL
IDHKKTGYMSIIRNLEDSYTNWIPAAIPFLRIMHVIKDNTGNEFPAVKRYLVDLNSPLFN
VLKEVRSLWSLYDLYRSPGPIQFNGHLGNARCYTVKTPTKDNLLCQNADDLELIINLTNK
NMYENNGDNNHNISDDKARDGGSSPTSSAKKTKYNLSDDNNNNNNNNINNVSTNYNNTSD
GSTFGNTTLLNTAYNVNGDGMNTLNCQKSNTSDVLSSEPVNQGFYEQHASSYKSLGCMSE
LQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFH
DKYASPISFEIRIGIVFLSRQAPGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLHNKYIII
DDDNIAKYVNQGGLELTGNSPEHSLFDKENRNKVCETVTKLQLNGLVMPGSNITITEAAL
LSEYFLEKKIPTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKY
WHFIRLMGRSPSHEVLECALQTHPNVVIISEEYGAADKTLWRVVQDIADVVCARADVGKN
YGTVLIPDALLMHLPHMKILLSEISDILNEASEKGQLLEARNDLVNLSGVDHGHLTSEWV
SKLTPWSLALLKTFPQFIIKELLQVDLRSMRFEQLETEQLLLQMVKEELQDRKQKGKYSG
SFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIVSIRGLCGNVKDWKL
FAIPFISLMKILPKGQGSKYLKSASKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRF
CNPGPIQFEGNASNYYNRILFEEQSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQ
LCGMLVLAYKPNDILSNMPYIGSIEDYYDWENQRKRMN
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atggataccaagagtggagataaaaatgctgcaaataagggaggagctgatgggcttgta
aagactgtgtcagtattactacgagataacaaatgtcagtttaatattgatgaaaattat
gatcataatgataaagagaaattagagtgtgaggtaggtaaacgtgatagtggtatgata
aattgtttgatggagaaattgacatctaagaaatttttagaagagaaagaaagtaaaaat
agtttttatttagtagataatgaaaatatgaaaataaaaaaattaaaagaacatggtcat
tcagcttcattaaatgatgatttaagtccattacaatatgaaagaacaaaatatatacca
agcttacccaaagctttagctagtgaatatcaaatattagatgaaaattatggagatgaa
tttataaataaaaatgattatgaagatgtaaagaggtttttaaaaaatttacataattta
ccaatgctaaatgttaaagatagtaataataatgaatcatttaaaggtggaaatatttta
aaaattggtattattttatcgggtggtccagctcctggtggtcataatgtaatatctggt
atttatgattatgctaaacgatataatgaacaatcacaagttattggatttcttggtggt
attgatggtttatatagtaaaaattatgttactataacagatagtatgatgaatcgattt
cgtaatttaggtggttttaatatgttatggtcaggtagaggaaaagtaaaaaataaagat
gatttgattgctatcgaaaatattgtagccaaattaaaattaaatggtttagttattatt
ggtggtgatggctcaaatagtaatgctgctttaatggctgaatattttgctgaaagacaa
attcctatatccattattggtgtacctaaaactattgatggtgatttaaaaagtgaggct
atagaaattagctttggttttgatactgctactagaacatactcagaaattattggaaat
ttatgtactgatgtaaaaactggtcataatgtataccatgttgttcgtgttatgggtaga
tcagcatcacatgttgttttagaatgtgctttacaaacaagaccaaatgttgttctaatt
ggtgaagaagttgaacaattgaatttgtcccttaaagatattgttaaaaatattgttaat
attatattgaaaagaaaatcattaaataaaaattatggtgttatcttattacctgaaggt
ttaattgaatttgtacctgagatgaaaatattaatttctgaattaaatgttatattaaaa
gatggtccatttgatgcttcgaaacttcaaaagtctaaagaagtttgggatttcttacca
cctattattagagatcaattgttaatggatagagaatcaactgggtatattcaagttgga
aaaatcgcaaccgaaagattaattattgtattagtagaatctgaactagccaaattaaat
gataaaaacctaaatatacaatttatgtcacattatctaggttatgaaggtagatgtgct
ataccatcaaattttgattgtaattattgttatgcattaggttacaacgctgcactttta
attgatcataaaaaaacaggatatatgtcgattattagaaacttggaagattcatatacc
aattggataccagctgcaattccatttttacgaattatgcatgtaattaaagataacaca
ggtaatgaattcccagctgttaaaagatatttagttgatttaaatagtccattatttaat
gtattaaaggaagtaaggagtttgtggtctctttatgatttatatagatctccaggacct
atccaatttaatggccatttaggtaatgcacgttgttatactgtaaagactccaacaaag
gataatttgttatgtcagaatgccgatgatttagagcttattataaatctaactaacaag
aatatgtatgaaaataatggggacaataatcataatatatctgacgataaagcaagggat
ggtggatcatcaccaacaagttctgctaagaaaacaaagtacaatctaagtgatgataat
aataataataataataataatatcaataatgtaagcactaattataataatacatcagat
ggatccacctttggtaatactaccttattaaatacagcctataatgtaaatggtgatgga
atgaatactttaaattgtcaaaaaagcaatacatctgatgttttgtcttcagaacctgta
aaccaaggattttatgaacaacatgcatctagttataaatcattaggttgtatgtccgaa
ttacaaacatctaggttgtataataaattagaattgcccgaattatgttctgatttgaaa
gcaaaggttagagcaggaaaacagtatatatccaatgatccatatacacaaaaacaaatc
ttatcaaattaccctcatatgtcttatgagaacaaatttcagatacaagaaatatttcat
gataaatatgctagtcccatttcttttgaaataagaattggtatagtatttttatcaaga
caggctccaggtgctatgaatgtgttatgtggtttatataggcgtttgaaattattaaaa
ggtgtttgtattgcattttacggattatatggattattacataataaatacattataata
gatgatgataatatagcaaaatacgtaaatcaaggaggtttagaattaactggcaattct
ccagagcattcattatttgataaagaaaatagaaataaagtatgtgagacagttacaaaa
ttacaattgaatggtttagttatgccaggatctaatataactattacagaagctgcttta
ttatcagaatactttttagaaaaaaaaatacctacatctgttgttggtataccattaaca
ggatctaataatttgatacatgaattaatagagacatgtgttggttttgatagtagtaca
aaagtatatgcatcattaataggtaatgtattgacagatgctgtaagtatgcctaagtat
tggcattttattcgtttaatgggaagatctccatcacatgaggttttagaatgtgcttta
caaacacatccaaatgtagttattatatcagaagaatatggagctgcagataaaacatta
tggagagttgttcaagatattgctgatgttgtatgtgcacgagctgatgttggaaaaaat
tatggtactgtattaattccagatgctttattgatgcacttaccacatatgaaaatatta
ttatctgaaataagtgatatattaaatgaggcatcagaaaaaggccaattattagaagca
agaaatgatttagtaaatttatctggtgtggatcatggtcacttaacatcagaatgggtt
tctaaattaacaccatggagtttagcattattaaagacattcccacaatttattataaaa
gaattattacaggtagatttgagatctatgcgttttgaacaattagaaactgaacaatta
ttattacaaatggttaaagaagaattacaagatagaaagcaaaaaggaaaatattcagga
agtttcatgggcttaacacacttttttggttatcaaggacgttcatcattaccatcagaa
tttgattgtaagttagcatatgcatatggacatgcagcatcaatagttattgaaagtggc
ttaacaggatatattgtatctataagaggattatgtggtaatgttaaagattggaaatta
tttgctataccattcatatcattaatgaaaatattaccaaaaggacaaggaagtaaatat
ttaaaaagtgcatctaaaggtgatttaccagtaattcctagtgcacctgtagatttgaat
ggaaaagcttatagaagcttaaaaattgctttacaaaaatggcaaatggaagatcgtttt
tgtaatcctggaccaatacaatttgaaggtaatgcatctaattattataataggatatta
tttgaagaacaatctgaatattttgaaatgttaagatatgttgaatgttatgcaaatatt
ttaaaagatacttgtcgttttggtgtctcagctgattatctgaaaaatgtatttgtacag
ttatgtggtatgttggtattagcatataagcctaatgatatcttatctaatatgccatat
attggaagtatagaagattattatgattgggaaaaccagagaaaaagaatgaactaa

DBGET integrated database retrieval system