KEGG   Plasmodium falciparum HB3: PFHG_01792Help
Entry
PFHG_01792        CDS       T01052                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pfh  Plasmodium falciparum HB3
Brite
Enzymes [BR:pfh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFHG_01792
Peptidases [BR:pfh01002]
 Cysteine Peptidases
  Family C86
   PFHG_01792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 143 aa AA seqDB search
FFSYIKRGMYSFGNFNISVLYFLMNKHNMELQWVDNKEICQKLKDHKNSAILFNDEQLND
KTLIALIINIVKLKFFDIYHHRHFYTIRKISDSWFKLDSSLNKPILLPTNKDVNNHLINI
VKNNKIQKSDNYIIQVFQKVKDN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
tttttttcttatattaaaagaggtatgtattcctttgggaattttaatataagtgttttg
tattttttaatgaacaaacataatatggaattacaatgggttgataataaagaaatatgt
caaaagttaaaagatcataaaaactctgccatattatttaatgacgaacagctgaatgat
aaaacattaatagcactcattataaatattgtaaaattaaaattttttgacatataccat
catagacatttttataccatacgaaaaatatcaggtatgtattatatatatatatatata
tatatatttatatatatatataactaaaaagataaaataaaataaaataaaataaggacg
aaattataaaaagaaaacatttttaaaaaataatacaatgttttttttttcttttttttt
taaatataatttatatttcttttataacatcatatgtcattcttgttatatttctattat
ttatagattcatggtttaagcttgattcatctctaaataaacctattttacttcctacta
acaaagatgtaagctaaaaggaaagaaaataaatatatatttcattatataatattatct
atcatgtttcataaatacttaaatgtaattttttcttttcctatatatgatatatattaa
atattatcctcattatcatatttttaaaaactcctaattttcttaatttcccttattttt
aacatatattttgtatttatgtttggtaatataagggaatcctttcctcagatttacaca
tatatatatatatatatatatatataagtaatacatatattatatatataatatctttaa
ataatttattaatttatttttgctcaggttaataatcatttgataaatattgttaaaaat
aacaaaattcaaaaatctgataattatattattcaggtttttcaaaaagttaaggataat
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system