KEGG   Plasmodium falciparum HB3: PFHG_01814Help
Entry
PFHG_01814        CDS       T01052                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pfh  Plasmodium falciparum HB3
Brite
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PFHG_01814
Protein kinases [BR:pfh01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PFHG_01814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Structure
PDB: 

Jmol
AA seq 508 aa AA seqDB search
MLKKKKDYENADLEDCNTKEIKGYSKVGSEKNIKKKMTSIKESSSRDEEEEDANVNKNIK
KFKEGNKKDNISKNCNIVEKKNNKSKEEKINIKEAIIKNVKVPDNYEIKHLIGRGSYGYV
YLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPEDLLKF
DELYIVLEIADSDLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLL
NQDCSVKICDFGLARTINSDKDIHIVNDLEEKEENEEPGPHNKNLKKQLTSHVVTRWYRA
PELILLQENYTNSIDIWSTGCIFAELLNMMKSHINNPTNRFPLFPGSSCFPLSPDHNSKK
VHEKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEGI
DLLESMLRFNAQKRITIDKALSHPYLKDVRKENLENFSTEKIILPFDDWMVLSETQLRYI
FLKEIQSFHADLIIPAKLNIHQKSFYNM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaaaaaaggattacgaaaatgctgatttagaggattgcaataccaaagag
ataaagggatattcaaaagtagggagcgaaaaaaatataaaaaaaaaaatgacttctata
aaagagtctagtagtagggatgaagaagaagaagatgctaatgtaaataaaaatattaaa
aaatttaaagaaggcaataaaaaagacaatatttcaaaaaattgtaatattgtagaaaag
aaaaataataaaagcaaagaagagaaaataaatatcaaagaagctattattaaaaatgta
aaggtaccagataattacgaaataaaacatttgattggtagaggatcctatggatatgta
tatttagcttatgataaaaatgcaaataaaaatgtggctataaagaaggttaatagaatg
tttgaagatttaatagattgtaaaagaatattaagagaaataacaatattgaatagatta
aagagtgattatattataagattacatgatttaattattcctgaagatttattaaaattt
gatgagttatatatagtattagaaattgcagattctgatttaaagaaattatttaaaaca
ccaatatttttaacagaacaacatgtaaaaacaatattatataatttattactaggagaa
aaatttattcacgaatcaggtataatacacagagatttaaagccagctaattgtttatta
aatcaagattgttcagtaaagatatgtgactttggtttagctagaacaattaattcagat
aaagatattcatattgttaatgatttagaagaaaaagaagaaaatgaagaaccaggtcca
cataataaaaatttaaaaaaacaattaactagtcatgtagttactaggtggtatagggca
ccagagcttatattattacaagagaattatacaaattctatagatatatggtcgactggt
tgtatatttgctgaactattaaatatgatgaagagtcatataaataatccaactaataga
tttcccttatttcctggatcttcttgttttcctttatcacctgatcataattcaaaaaaa
gttcatgaaaaaagtaacagggatcaattaaatataatatttaatgtaataggtacacca
cccgaagaagatttaaaatgtataacaaaacaagaagttattaaatatattaaattattt
cctacaagggatggtatagatttaagtaaaaaatattcatctatatctaaagaaggtata
gatttattagaatccatgttacgatttaatgctcaaaaaagaataactattgataaggct
ttatcacacccttatcttaaggatgtaagaaaagaaaatttagaaaatttctcaaccgaa
aaaataatacttccatttgatgattggatggttctatcagaaacacaacttagatatatt
ttcttaaaggaaattcaatcatttcatgctgatttaattatacctgcaaagttaaatata
catcaaaaaagtttctacaatatgtaa

DBGET integrated database retrieval system