KEGG   Plasmodium falciparum HB3: PFHG_02270Help
Entry
PFHG_02270        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFHG_02270
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFHG_02270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFHG_02270
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFHG_02270
Enzymes [BR:pfh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PFHG_02270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 541 aa AA seqDB search
MLKFNCIPYKNIGTFHDALKQHNIKFEKRNNFIFFHAFSSLRKYKSQHSEKNNILNKLFF
FKKEYKSYFHKLSNNLFLSSKRKNEVIFHKMDKTNKNVQMIKHNIITSQRRENGMEQYTA
IDGKTKVNNNNNNDNSNNNNDNSNNNKNNNNDMKANIHQDMDKVKNNMIDLELSELWTKK
SLIVNFQNNICEIILNRPEKLNAINKDMINALLNIIKSLDNDERCFMVIIRSTNSNCFSS
GSDVKYVVENKEQGIQHLKQLYLYINYISHMKKNLLCIWNGYVMGGGLGISIYSKYKVIN
KNAIFAMPENKIGFFPDIGCCYFFRKYFGRNIGLHLGLTSLRLNEVDLINFNVCNNYIEN
VDTFMDNLNNIKATNQEDFNKKLNNLLTNKYVSKMSYNKSNNPVLTDELINNINTYYSSA
NTLEDLITKLKKDNNDFCKKLLSDIYSNCYFSCMFWFSYYLYNYEKSLEEVLNNDFKITQ
YFLFHKNSFERGVTEVLVKKNKNFQWSKDEETNNADFEDIDDILMNKNLLSIKEEFTNMS
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtttaattgcataccttataaaaatataggaacctttcatgatgcccttaag
cagcataatataaaatttgaaaaaagaaacaattttattttttttcatgctttttcatct
ttacgtaaatataaatcacaacattctgaaaagaataatattttgaataaattatttttt
tttaaaaaagaatacaaaagttacttccacaaactttccaataatttgttcttgtctagt
aagagaaaaaatgaagtaatatttcataaaatggataagacgaataaaaatgttcaaatg
attaaacataatattataactagccaaagaagagaaaatgggatggaacaatatactgct
atagatggtaaaaccaaagtaaacaacaacaataataatgataatagtaataacaataat
gataatagtaataacaataaaaataataataatgatatgaaagcaaatattcatcaagat
atggataaagtaaaaaataatatgatcgatttagaactatcagaattatggactaaaaaa
tcattaattgttaattttcaaaataatatatgtgaaataattttaaataggcccgaaaaa
ttaaatgcaataaataaggatatgataaatgcattattaaatataataaaaagtttagat
aatgatgaaagatgttttatggtaataattcgaagtactaacagcaactgtttttcatca
ggctcagatgtaaaatatgttgttgaaaataaagaacaaggtatacaacatttaaaacag
ctatatttgtatattaattatatatcccatatgaaaaaaaatttattatgtatatggaat
ggatatgttatgggaggtggtctaggaatttctatttattcaaaatataaagtaataaat
aaaaacgctatatttgccatgcctgaaaataaaataggttttttccctgatattggatgt
tgttattttttcagaaaatattttggaagaaatataggtttacatttaggtttaacatca
ttaagattaaatgaggtggatttgattaattttaatgtgtgtaataattatattgaaaat
gttgatacttttatggataatttgaataatataaaagcaacaaatcaagaagatttcaat
aagaaattaaataatttattaacaaataaatatgtttcaaaaatgtcttataataagtct
aataatccagtcttaacagatgagttaattaataatattaatacatattatagtagtgca
aataccttggaagatttaataaccaaattaaaaaaagataacaacgatttctgtaaaaag
ttattatctgatatttattctaattgctattttagttgtatgttctggttttcttattat
ttatataattatgaaaaatcattagaagaggtattaaataatgatttcaaaattactcaa
tattttctgtttcataaaaattcttttgaaaggggtgtaacagaagtattggtgaaaaaa
aataaaaactttcaatggagcaaagacgaagaaacaaataatgccgactttgaagatatt
gacgatattttgatgaacaaaaatttgttgtcaataaaggaagagtttacaaatatgagt
gaataa

DBGET integrated database retrieval system