KEGG   Plasmodium falciparum HB3: PFHG_02391Help
Entry
PFHG_02391        CDS       T01052                                 

Definition
hypothetical protein similar to aspartate transcarbamoylase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PFHG_02391
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFHG_02391
Enzymes [BR:pfh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PFHG_02391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 298 aa AA seqDB search
MFYINSKYKIDLDKIMTKMKNKSVINIDDVDDEELLAILYTSKQFEKILKNNEDSKYLEN
KGETVEDAFKILSTYVDGIIYRDPSKKNVDIAVSSSSKPIINAGNGTGEHPTQSLLDFYT
IHNYFPFILDRNINKKLNIAFVGDLKNGRTVHSLSKLLSRYNVSFNFVSCKSLNIPKDIV
NTITYNLKKNNFYSDDSIKYFDNLEEGLEDVHIIYMTRIQKERFTDVDEYNQYKNAFILS
NKTLENTRDDTKILHPLPRVNEIKVEVDSNPKSVYFTQAENGLYVRMALLYLIFSSTS
NT seq 1327 nt NT seq  +upstreamnt  +downstreamnt
atgttttatatcaatagcaagtataaaattgatttggataaaatcatgacgaaaatgaaa
aacaaaagtgtaattaatattgatgatgtagatgatgaggaattattggctatcttatat
acatccaaacaatttgaaaaaatattaaaaaataatgaagatagcaaatatttagaaaat
aaagttttctgtagtgtgttcccttgaaccaagtacaagaacaagatgttcttttgatgc
tgcaattttaaaattaggttccaaggttttaaatatcactgatatgaattcaacttcttt
ttataagggagaaactgttgaagatgcctttaaaatattgtcaacatatgtggatggaat
tatatacagagatccatcaaaggtaagaaaataaatgaaattaaaatgtgaactgaaagt
tgattattactaaatgaataaatttatgcatatatatatatatatatatatatattttta
tttatttattttcctttttagaaaaatgtcgatattgctgtttcttcttcaagcaagcca
attattaatgccggtaatggaacaggcgaacatccaactcagtccctcttagatttttat
acaattcataattactttccatttattctagatagaaatataaataaaaagcttaatata
gctttcgttggagatttgaaaaatggaagaactgtacattcacttagcaaactacttagc
agatacaacgtcagttttaatttcgtttcatgtaaatcgttgaatattcctaaagatata
gtaaatacaattacgtataacttaaaaaaaaacaatttctatagtgatgattctatcaaa
tattttgataatttagaggaaggattagaagacgttcatataatttatatgaccagaata
caaaaagaaagatttactgatgtggatgaatataatcaatataaaaacgcattcattctg
agtaataaaactttagaaaacacaagagacgacacaaaggtaataatgttaaaaaaaaaa
aattaaaatttatatttacgtatatttacatatttgtttatttatttattttttcgtttg
tttgtttatttatttgtttatttatttatatattttatttatgaagattataatatttaa
tgcatgtaaaatatatacatacatatatatatttatatatttatagatacttcaccctct
tccaagagttaacgaaataaaagttgaagtagatagtaatccaaaaagtgtttatttcac
acaagcagaaaatggattatatgtaagaatggctttattatatctcattttttcatcaac
tagctag

DBGET integrated database retrieval system