KEGG   Plasmodium falciparum HB3: PFHG_02567Help
Entry
PFHG_02567        CDS       T01052                                 

Definition
hypothetical protein similar to dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFHG_02567
Enzymes [BR:pfh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PFHG_02567
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PFHG_02567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 678 aa AA seqDB search
METIQELILSEENKTNIAVLNLGTNDRRNAVLILETALHLVEKYLGKIINTSYLYETVPE
YIVLDKKESCEKINKDCRIYDVNYINELMQNLEESKYEENKELIDKCEEYETFLKNGKVD
NSILKEVNVENYLLECNNIIVKNDEIMKNNLSKYKDKYYTSYFYNLTVVVKTFVNDPLSM
LVVIKYIEELMKRENVKEKEKFENRIIDIDILFFNDFTIFMKNIKLEKNMIYKILSKYIH
LERDIKNGNDNMSKVNMDKDINLNNNNNIKKKNNNDIDCDCVDQKMNNHVNNKNYINSFR
DPQEIINNMVDNIEFLSIPHVYTTHRYSILLCLNDMIPEYKHNVLNNTIRCLYNKYVSRM
KEQYNINIKENNKRIYVLKDRISYLKEKTNIVGILNVNYDSFSDGGIFVEPKRAVQRMFE
MINEGASVIDIGGESSAPFVIPNPKISERDLVVPVLQLFQKEWNDIKNKIVKCDAKPIIS
IDTINYNVFKECVDNDLVDILNDISACTNNPEIIKLLKKKNKFYSVVLMHKRGNPHTMDK
LTNYDNLVYDIKNYLEQRLNFLVLNGIPRYRILFDIGLGFAKKHDQSIKLLQNIHVYDEY
PLFIGYSRKRFIAHCMNDQNVVINTQQKLHDEQQNENKNIVDKSHNWMFQMNYMRKDKDQ
LLYQKNICGVFKKKKKFK
NT seq 2231 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatacaagaactaatactttctgaggaaaataaaactaatattgccgtatta
aacttaggaacaaatgatagaagaaacgctgtgttgattctagaaactgctctgcacctt
gtcgaaaaatatttaggtaagaaaaaagtataataaataaataaataaatacacaaacaa
agaaatatatatatatatatatatatatatatatatatatatatatatatatatgtgtat
atacatacttttatatacatacctttatatacatacttttatatacatatcactctttga
ttctatatatttttatttttcactttgtaggaaaaattattaatacgtcctacttgtatg
aaaccgttccagaatacattgtattagataaaaaggaaagttgcgaaaaaataaacaagg
attgtcgtatatatgatgttaattatataaacgaattgatgcaaaatttagaagaatcta
aatatgaagagaataaagaattaattgataaatgtgaagaatatgaaacatttttgaaaa
atggaaaagttgataatagtattctaaaggaagtaaatgtagaaaattatttattagaat
gtaataatataatagtaaagaatgacgaaataatgaaaaataatttaagcaaatataaag
ataaatattatactagctacttttataatttgacagttgtagttaaaacttttgtaaatg
atcctcttagtatgttggtagttataaaatatattgaagaattaatgaaaagggaaaatg
taaaagagaaagaaaaatttgaaaatcgtataatagatatagatattctattttttaatg
attttacaatctttatgaaaaacataaaattggaaaaaaatatgatttataaaatactct
caaaatatattcatttggaaagagatataaaaaatggaaatgacaatatgtctaaagtaa
atatggataaagatataaatcttaataataacaataatataaaaaaaaaaaataataatg
atattgattgtgattgtgtggatcagaagatgaataatcatgtgaataataaaaattata
taaattcttttagagatccacaagaaataataaacaatatggtagataatattgaatttt
tatccattcctcatgtgtatacaacacacagatatagcatacttttatgcttaaatgata
tgatacccgaatataagcataatgttttaaataataccatcagatgtttatataacaaat
atgtgagtaggatgaaagaacaatataatataaatattaaagaaaataataaaaggatat
atgtattaaaagatagaatttcttatttaaaagaaaaaacaaatattgttggaatattaa
atgttaattatgattctttttcagatggaggtatttttgttgaacctaaacgtgctgttc
aaagaatgtttgaaatgataaatgaaggtgctagtgttatagatataggtggagaatcct
ctgctccttttgttatacctaatccaaaaattagtgaaagagatttagtagtacctgtat
tacaattatttcaaaaagaatggaatgatataaaaaataaaattgttaaatgtgatgcga
aaccaattataagtattgatacaattaactataatgtttttaaagaatgtgttgataatg
atttagttgatatattaaatgatattagtgcttgtacaaataatccagaaattataaaat
tattaaaaaaaaaaaacaaattctatagtgtagttctaatgcataaaagaggaaatccac
atacaatggataaactaacaaattatgataatctagtttatgatataaaaaattatttag
aacaaagattaaattttcttgtattaaatggaatacctcgttataggatactatttgata
ttggattaggatttgcgaagaaacatgatcaatctattaaactcttacaaaatatacatg
tatatgatgagtatccactttttattggatattcaagaaaaagatttattgcccattgca
tgaatgatcaaaatgttgtaataaatacacaacaaaaattacatgatgaacaacaaaatg
aaaataaaaatattgtggacaaatcacacaattggatgtttcagatgaattacatgagga
aagacaaggatcaacttttatatcaaaaaaatatatgtggtgtgtttaaaaaaaaaaaaa
aattcaaatga

DBGET integrated database retrieval system