KEGG   Plasmodium falciparum HB3: PFHG_02705Help
Entry
PFHG_02705        CDS       T01052                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
pfh  Plasmodium falciparum HB3
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SAA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagctcaaaaatcccaagcagccaaaaaaactgctggaaaaacc
ttaggaccaagacataaaagaaaaagaagaactgaatctttttcactttacattttcaaa
gtcttaaaacaagtacatccagaaacaggagtaaccaaaaaaagtatgaatattatgaac
tcctttattaatgatatatttgacagattagttactgaagccacaagacttattcgttat
aataaaaaaagaactttatcatcacgtgaaattcaaacagctgtaagattattattacca
ggagaattatcaaaacacgccgtttcagaaggaacaaaagctgtaaccaaatatacaaca
agtgctgcttaa

DBGET integrated database retrieval system