KEGG   Plasmodium falciparum HB3: PFHG_02738Help
Entry
PFHG_02738        CDS       T01052                                 

Definition
hypothetical protein similar to 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFHG_02738
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PFHG_02738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 537 aa AA seqDB search
MNQFLNLKCVLFYFFCTHLFFLHVITKHNLKKEKGYIIRNDYKCKRKRKNNNLKKRSFFI
ICKNCRPNNNKFYIINNKGGENINNVKKKKACGYVRLNNEANVEKNNVVNTNKEIEKLLL
DVLDNRNNWYDSKYFSPAKINLFLRLKEKKETYNEVSTLMHSLNLGDDIFIRALKKEDQN
KLRHFLHPCESGDFLTIVRMEDKNRDKETLKEDCKIDVINKSDKDLFKHMKEDIIIQEHE
KLPYEYNDYPINNDNIIIKVLKRYREEFNISDDIRFLIHVNKRIPIFSGVGGGSSNGATV
FYFLENIFYKYFKGDNIKANEFLKTIGSDISFFSSSGFAYCTDKGNNVTDLKNIEANIKD
KDIYLFKIDEGLSSKLVYKNVDYKRIIQYNPVNLLKCLINTSNDDIIKQIEEKEKKFANT
FISLDNRDNLQNVFVNDLEHSAFYLIKKLQDLKEYLRSQNMFDVVSMSGSGSSLFALSNK
KTQTHEISSSFQNERIKKLISDIKIKFNMNVRVYLCDALRKGLDVWYDPIKLAHEFK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagttcttaaacctaaaatgtgttttattttattttttttgtacgcatttattt
tttctccatgtaataactaagcataatttaaagaaagaaaaaggatatataataaggaat
gattataaatgtaaaaggaaaaggaaaaataataatttaaaaaagcgatctttttttata
atatgtaaaaactgtagaccaaataataacaaattttatattattaataataaaggaggt
gaaaatataaataatgttaaaaaaaagaaagcatgtggatatgtacgtttaaataatgag
gctaatgttgaaaagaataatgttgtaaatactaataaagaaatagagaaattattatta
gatgtattagataatcgtaataattggtacgattcaaaatatttctctcctgcaaaaatt
aatttatttttaagattgaaggaaaaaaaagaaacatataatgaagtatcaaccttaatg
cattcattaaatttgggtgatgatatttttataagagctttgaaaaaagaagatcaaaat
aaattaaggcattttttacatccatgtgaatctggagattttttgacaatagtaagaatg
gaagataaaaatagagataaggaaacattaaaagaagattgtaaaatagatgttattaat
aagagtgataaagatttatttaaacatatgaaagaagatataataattcaagaacatgaa
aaattaccatatgaatataatgattaccctataaataatgataatattattattaaggtt
ttaaaaagatatagagaagaatttaatataagtgacgatataagatttctaatacatgta
aataaaagaatacctatatttagtggtgttggtggtggctcatctaatggtgctactgtt
ttttatttcttagaaaatattttttataaatattttaaaggtgataatataaaagcaaat
gagtttttaaaaactataggaagcgatatatccttttttagtagttctggatttgcttat
tgtacggataaaggtaataatgtaacagatttaaaaaacatcgaagcaaatataaaagac
aaagatatatatttatttaaaattgatgaaggtttatcatcaaaattagtatataaaaat
gtagattataagcgaataatacaatataatccagtgaatttattaaaatgtttaattaat
acatcaaatgatgatataattaaacaaattgaagaaaaagaaaaaaaatttgccaacact
tttatttcgttagataacagagataatttacaaaatgtatttgttaatgatttagagcac
tcagcattttatttaattaaaaagttacaagatttaaaagaatatttaagaagtcaaaat
atgtttgatgttgtatccatgagtggaagtgggtcttctttatttgctttatccaacaag
aaaactcaaacccatgaaatttcttcatcttttcaaaatgaacgaattaaaaaactaata
agcgatataaagataaaatttaatatgaatgttagggtttatttgtgtgatgctttgcga
aaaggtcttgatgtttggtatgaccctatcaagctagcacatgagttcaagtga

DBGET integrated database retrieval system