KEGG   Plasmodium falciparum HB3: PFHG_02925Help
Entry
PFHG_02925        CDS       T01052                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFHG_02925
Enzymes [BR:pfh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PFHG_02925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 389 aa AA seqDB search
MYKYTSINKSDKIYETHNMEEKKKKGNNNNFSGLLNNEIDDNNKKEMLKNSISKMYSNHK
NRENFNECEKEDLVVIDEKDNNKKKKKNMTNTFEQDNNYNMNDNKRLGSFFKINDKCESI
NENVNNINKQSLKDSILFDNINEKEYFNETKEENKEGNKSNDIEKINCMKVKKKTVKKNK
KKINKIINNKNKISKSNDIEEQIINISKHIYKILNISKLPKCDILKRTNRRYAETFLYLT
NGYNLDIEQIIKRSLYKRMYKNNSIIKVTGIHIYSLCKHHLLPFEGTCDIEYIPNKYIIG
LSKFSRIVDVFSRRLQLQEDLTNDICNALKKYLKPLYIKVSIVAKHLCINMRGVKEHDAK
TITYASYKAEKENPTVHSLNIDSSVENLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatatacgtcaataaacaaatctgataaaatatatgaaacacataatatggaa
gaaaaaaaaaaaaaaggtaataataacaatttctcaggattattaaataatgaaatcgat
gataataataaaaaggaaatgttaaaaaatagtatatctaaaatgtatagtaaccataag
aatagagaaaattttaacgaatgtgagaaggaagaccttgttgtgatagatgaaaaggat
aataataaaaagaaaaaaaaaaatatgacaaatacatttgaacaagataataattataat
atgaatgataataaaaggttaggtagcttttttaaaataaatgataaatgtgaatctatt
aatgagaatgttaataatattaataaacagtctcttaaggattctatactatttgacaat
ataaatgagaaagaatattttaacgaaaccaaagaagaaaataaggaaggaaataaaagt
aatgatatagaaaagataaattgtatgaaagtgaagaagaaaactgttaaaaagaataaa
aagaagattaataaaattataaacaataagaataaaatatctaaatcaaatgacatagaa
gaacaaataattaatattagtaaacatatatataaaatattaaatatatccaaattacca
aaatgtgatatattaaaaagaacaaatagaagatatgctgaaacatttttatatttaact
aatggttataatctggatatagaacaaataataaaaagatctttatataaaaggatgtat
aaaaataattcaataatcaaagttacaggtatacatatatattcattatgtaaacaccat
cttttaccttttgaaggtacatgtgatattgagtatatacccaataaatatattatcggg
ttatctaaattttcaagaatagttgatgtcttttctagaagattacaattacaagaagat
ttaactaacgatatttgtaacgctttaaaaaaatacttaaaaccattatatattaaagta
tctattgtagctaaacatttatgtataaatatgaggggagttaaagagcacgatgctaaa
actataacgtatgcatcttataaagcagaaaaagagaatcctacagttcattctttaaat
attgactcttctgtggaaaatttaaattag

DBGET integrated database retrieval system