KEGG   Plasmodium falciparum HB3: PFHG_03031Help
Entry
PFHG_03031        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PFHG_03031
Enzymes [BR:pfh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PFHG_03031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 423 aa AA seqDB search
MKVYNFSFICISLIFVFIKRSLGLYTNVAEIETVDNPKRLEELLNLKKVYLVQFYATWCR
VSRGFSNDFINIAKTLKDDVKFIAIKNESILNEYKITEYPTMHLIFGNEHNNKKEVEKFD
GKYKIKDVVSFIYEGIKNYRLKELNIDTSKKSSYKKKSKGKNDGKVIILNDSNFDQNVIQ
YDDNVWFVFFYAPWCGHSKPIHPMFDELAKKVAHLKNAKIAKIDATVEQRTAQTYQINHY
PSFRLFPSGNKKPHTAIDYNDSRTVDDLYHFFLKYYVEKKELIQLTSQQVFDEFCEKDVC
LLALLPNKEDTEPSYFKSYVHILSNVIKDVNHLPVTLLWTQAGDQLDIVQKLNLTFGFPT
VIALSLSKNVFSILKGNYSEQSIKNFITQMMMGKSSVDNLVPFKVKNVPKFSFNASNDIN
TEL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtataatttttcattcatatgtataagtttaattttcgttttcattaaacgt
agcttgggattatatacaaatgtagcagagatcgaaacagttgataaccctaaacggtta
gaagaattattaaatttaaaaaaagtgtatcttgttcagttttatgccacatggtgtagg
gtttcacgaggtttttctaacgacttcatcaatatagcaaaaacattaaaagatgatgtt
aaatttatagctataaaaaatgaaagtatattaaatgaatacaagattactgaatatcca
acaatgcatttaatttttggaaatgaacataataataaaaaagaagtagaaaaatttgat
ggaaaatataaaatcaaagatgtagtttcttttatatatgaaggtattaaaaattatcgt
ttaaaagaattgaatatagatacatccaaaaaaagttcatacaaaaaaaaatctaaaggt
aaaaatgacggaaaagtaatcattttaaatgatagtaattttgatcaaaatgttatacaa
tatgatgataatgtatggtttgtctttttctatgctccatggtgtggtcatagtaaacct
atacatccaatgtttgatgagctagccaaaaaagtagctcatttgaaaaatgctaaaata
gctaaaattgatgctacagtagaacaaagaacagcacaaacgtatcaaataaatcattat
ccatcttttagattatttccatcgggaaataaaaaacctcatactgcaattgattataat
gattcaagaactgttgatgatttatatcatttctttctaaaatattatgttgaaaaaaaa
gaattaattcaattaacatcacaacaagtttttgatgaattctgtgaaaaggatgtatgt
cttttagctctcttaccaaataaagaagatacagaaccttcatattttaaatcgtacgtt
catatattaagtaatgttattaaagacgtaaaccatttaccagttacattattatggaca
caagcaggtgatcaattggatattgttcaaaaattaaatttaacatttggtttcccaaca
gtaattgcattaagtctttcaaaaaatgttttttctatacttaaaggtaattattctgaa
caatccataaaaaattttattacacaaatgatgatgggcaaatcatccgtagataattta
gtaccatttaaagtaaaaaatgttccaaagttttcttttaacgcttctaatgatataaat
accgaattgtaa

DBGET integrated database retrieval system