KEGG   Plasmodium falciparum HB3: PFHG_03868Help
Entry
PFHG_03868        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PFHG_03868
Enzymes [BR:pfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PFHG_03868
Exosome [BR:pfh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFHG_03868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 487 aa AA seqDB search
MNVILSIDQSTQSTKVFFYDEKLNIVHSNNLNHEQKCLKPGWYEHDPIEIMTNLYNLMNE
GIKCITNQRETVIIWDRITGKPLYNAIVGLDTRVEELVTEFSAKYNNNDIQKKTGTYFNT
YFSAFKILWLIQNNPEIKQKIDDGTAVIGNINTWLIFNLTKGNCYTDVTNASRTLLMDIN
TLQWDEKMCKIFNITNMSVLPEIKSNCSNFGLVKSEHVPDYLNIPITGCIGDQQSACIGQ
AIFDEGEAKCTYGTGVFLLINTGEKVVYSTCGLITTICYKFNDNDKPKYALEGSIGTAGS
GVSWLLKNKLIDDPSEASDIMEKCENTTGVIFVPAFSGLYAPRWRSDARASIYGMTFNTE
RSHIVRALLEGIAFQLNEIVDSLTSDMGIEMLHVLRCDGGMTKNKPFMQFNSDIINTKIE
VSKYKEVTSLGAAVLAGLEVKIWDSLDSVKSLLRRSDAVFHSKMDDKKRKKKTSEWNKAV
ERTLIQL
NT seq 1502 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcatattaagtatagaccaaagtacccaatcaaccaaagtgtttttctatgat
gaaaaattaaatattgttcattccaataatttaaatcatgaacaaaaatgtttgaaacct
ggttggtatgaacatgatccaatagagattatgaccaacttatataatttaatgaatgaa
ggaataaagtgtaaagataaatatacatctgtataataaaatgtataggtattactaacc
aaagagaaactgtaattatatgggatagaataacaggaaaacctttatacaatgctatag
ttgggctagatacacgtgtagaagaacttgttacggaattttctgcgaaatataataata
atgatattcagaaaaaaacaggaacttactttaatacatattttagtgcttttaaaatat
tgtggttaattcaaaacaatccagaaatcaaacaaaaaattgatgatggtactgcagtta
taggaaatattaatacatggcttatttttaatttaactaaagggaattgttatacagatg
ttaccaatgcttcaagaactttattaatggatattaatacattacaatgggatgaaaaga
tgtgtaaaatatttaatattactaatatgtctgttttacctgaaataaaaagtaattgtt
ctaattttggtttagttaagtcagaacatgttccggactatttaaatattcctattactg
gatgtattggagatcaacaaagtgcatgcattggtcaagctatcttcgacgaaggtgaag
cgaaatgtacatatggtacaggggtattccttctaattaatacaggagaaaaagttgtat
attccacatgcggtttaattactactatatgttataaatttaatgataatgataaaccta
aatatgctcttgaaggttcgataggtactgccggatctggagtttcatggcttcttaaaa
acaaactaattgatgatccaagtgaagctagcgatattatggaaaaatgtgaaaatacaa
ctggagtcatttttgtaccagctttcagtggattatatgcacccagatggagatctgatg
cacgtgcatccatatatggaatgacttttaatacggaaagaagccatattgtaagagcac
tattagaaggtatagcttttcagttaaatgaaattgtggactccttaacatcggatatgg
gtattgaaatgttacatgtcttacgatgtgatggaggcatgacaaaaaataaacctttta
tgcaatttaactcagatattattaatacaaaaattgaagtttcaaaatataaagaagtaa
cttctcttggtgctgcagttctagctggattagaagttaaaatatgggacagtctagatt
ctgttaaaagtttattaaggagaagtgacgctgtttttcattctaaaatggatgataaaa
aaagaaaaaaaaaaacttccgaatggaataaagctgtcgaaaggacattaatacagttat
aa

DBGET integrated database retrieval system