KEGG   Plasmodium falciparum HB3: PFHG_04042Help
Entry
PFHG_04042        CDS       T01052                                 

Definition
hypothetical protein similar to ubiquitin carboxyl-terminal hydrolase isozyme l5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pfh  Plasmodium falciparum HB3
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 465 aa AA seqDB search
MARDNENILEEWCLIESNPCIFYDMLKRMGATEISVEDVYSLSYFDDYINNKEIINMNHI
LGVDTYLGENNKTLDKENNVVDVIELYKNNICMEDKYNKLLKHHSYIYGIIFLFNIGKHY
KNNKYIEHNVPDNLFFAKQVIPNACATQAILSIVLNKDIELNDEIKNIKTFSLNFDSSMK
GLTLSNCTFLRNIHNSYKPPIYLDKEDVHHDKKKSEDSFHFVSYISFQDKVYLLDGLQSG
PVLINADEQNKPNPNNNNNNKDNDNDNNNNNNNNNNNNNNNNNNNNNNNNNNIGMNGKDW
IEISREHIKKEIDEICNSQTNNDVRFNIIAVMKDKEYIIQEYINIHRIVKQRVNIKLINL
GENIELSDEINEDEFPLLNDIPSIENLPNNVDTLYNIVNKSTLEINYLQSLLHEQKEIKK
LWNKELTFKFFNFYPFIMSSLNLMAKHKLLKDAYQKEKLKNATKS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggataatgaaaacattttagaagagtggtgtttaatagaaagtaacccgtgt
atattttatgatatgcttaaacgtatgggtgctacagaaatttcagtagaagatgtgtat
agtttatcttattttgatgattatataaataataaggagattataaatatgaatcatata
ttgggtgttgatacatatttaggagaaaataataaaactctggataaagagaataatgtt
gttgatgttatcgaattatataagaataatatatgtatggaagataaatataataaatta
ttaaaacatcatagttatatttatggtataatatttttatttaatattggaaagcattat
aaaaataataaatatattgagcataatgttcctgataatttattttttgctaaacaagtt
ataccaaatgcatgtgctacacaagctattttgtctattgtgttgaataaggatatagaa
ttaaatgatgaaataaaaaatataaaaacatttagtttaaatttcgatagttcaatgaaa
ggattaacattatcaaattgtacttttcttcgtaatatacataattcatataaacctcca
atatatttagataaagaggatgtacatcatgataaaaaaaaaagtgaagactcctttcat
tttgtttcctatattagttttcaggataaagtatatttattggatggtttacaaagtggc
cccgtgcttataaatgcagacgagcaaaataaacccaacccaaacaataacaacaataat
aaggataatgataatgataataataacaacaataacaataataataacaataacaacaat
aacaacaataacaacaataacaataataataacaatattgggatgaatggaaaagattgg
atagaaatttctagagaacatataaaaaaagaaatagatgaaatatgtaattcacaaact
aataatgatgttcgttttaacattattgccgttatgaaagataaagaatacattattcaa
gaatatataaatatacatcgcatagttaaacaaagagttaatatcaaattaattaacctt
ggagaaaatattgaactatcagatgaaattaatgaagacgaatttcccttattaaacgat
ataccctcaatagaaaacctaccaaacaatgtagatactttatataatatagtaaataaa
tcaaccttagaaattaactatttacaatcattattacatgagcaaaaagaaataaaaaaa
ttatggaataaagaactgacttttaaattttttaatttctatcctttcataatgtcttct
cttaatttaatggctaagcataagttattaaaagatgcttatcaaaaagaaaaattaaaa
aatgcaacaaaatcttga

DBGET integrated database retrieval system