KEGG   Plasmodium falciparum HB3: PFHG_04151Help
Entry
PFHG_04151        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PFHG_04151
Enzymes [BR:pfh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PFHG_04151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 362 aa AA seqDB search
MKRSFRSMLRSIFMRSLYFLTSNISSIIIFCVSISFLGYFGKELHNNNKLFNLYSKKHEY
EELDTKEKSQEKPFLNGKNQSFKLYKIIKLTPTVKIFIFSYPDEYEYLGLGICKHIKFNA
SNIEGKIKGKWNNNDDKEKNLKQISRSYTPVYIDKKKKHVHFIIRVYYPDDEYIDGGKMS
IQLNKLNNNDEIDINGPFGLLEYKGNNELLHLSKSVKIKKHIVMIAGGTGMTPFFRLINH
LLLTKEKELPSDPVYITFIYANRNENEILLKSIFDDYENRFENFKRVYSVDKCLNTNQMG
NFENIGFINEELLRKYVLKYEKLNIEVKNKDTLILLCGPPPMTSSIKSILKDQIHMENII
VF
NT seq 1193 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatcattcagatccatgcttagatccatctttatgagaagcctttatttttta
acatcaaatattagtagcataataattttttgtgtgtcgataagtttcttgggttatttt
ggaaaggagttacataataacaataaattatttaatttgtattcaaagaaacatgaatat
gaagaattagacacaaaagaaaaaagtcaagaaaagccttttttgaatggaaagaatcag
agttttaaattatataagataataaaattgacaccaacggttaagatatttatatttagt
tatcctgatgaatatgagtatttaggattaggtatttgtaaacatataaaattcaatgca
tcaaacattgaagggaaaataaaaggaaaatggaataataatgatgataaggaaaaaaat
ttgaaacagataagtcgaagttataccccagtatatattgacaaaaagaaaaaacatgtt
cattttattattcgtgtttattatccagatgatgaatatatagatggtgggaaaatgagt
atacaactaaataaattaaataataatgatgagatagatataaatggaccttttggatta
ctagagtataaaggaaacaatgaactcttgcatctttcaaaatctgttaaaattaaaaaa
catattgttatgattgctggtggtacaggaatgactcctttctttcgtttgataaatcat
ttattattaacaaaagaaaaggaacttccgagtgatcctgtttatatcacctttatatat
gctaacaggaacgagaatgaaatcttgttaaaatcgagtaataataaaaaaaaaaatata
tatatgtatgtatatatatatatatatatatatgtttatatatatacatctttccaattt
ttttattttttcattttatagtttttgacgattatgaaaacaggttcgaaaatttcaaga
gggtatacagtgtagacaaatgtttgaatactaaccaaatgggcaattttgaaaacatcg
gatttataaatgaagaattattaagaaaatatgttttgaaatatgaaaagttaaatattg
aagtaaaaaataaagataccttaattttattatgcggacctccaccaatgacaagttcaa
ttaaatcaatattgaaggatcagatccacatggaaaatattatagtattctaa

DBGET integrated database retrieval system