KEGG   Plasmodium falciparum HB3: PFHG_04508Help
Entry
PFHG_04508        CDS       T01052                                 

Definition
hypothetical protein similar to 2-oxoglutarate dehydrogenase complex E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFHG_04508
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFHG_04508
  Amino acid metabolism
   00310 Lysine degradation
    PFHG_04508
Enzymes [BR:pfh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PFHG_04508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 421 aa AA seqDB search
MTKNLVFRLNKSLLHHVKSFNRTFLNHKYNSNANIEGSLKRYFSIETIKVPRLGDSITEG
TINEWKKKVGDYVKADETITIIDTDKVSVDINSKVSGGLSKIFADVGDVVLVDAPLCEID
TSVEPPEDICKTKEEVGESKNNENNYTFNQLNRDIKDEAHIKDEVSKNEKDIFVKDPICF
GNDYESINERTERRVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKAMLLRSELNDIF
QKKYSCKLGFVSLFMYASTLALKKMPNVNAYIENDEIVYKNYIDISVAVATPNGLTVPVI
RNCQNKNLPQLELALSDLATKARSNKLSIDDFSGGTFTISNGGVFGSMLSTPIINMPQSA
ILGMHTIKNRPVVVNNEIVIRPIMYLALTYDHRLLDGREAVQFLCAIRDYIENPNLMLID
C
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaatcttgtatttcgattaaatgtaaatatatttaatatatattatgtatat
gtgtgtcgaattatataaatcgtatttatctattttttattagtatatattttaaaaatg
ttgaaaatatatacacatatataaatatatattatttgttttatttttatagaaatcctt
attacatcatgtcaaaagttttaatagaacatttttaaaccataagtataattcaaatgc
aaatattgaaggatcacttaagagatatttttccataggtaaatatttgaaaaaaaaagg
acgtttctaagttataaatatgggaaatatatatatatatatatatatatgtgtgtgtgt
atttttttttttttttttttgttaccctttgtagaaaccattaaagtacctagacttggt
gattcaatcacagaaggtacaataaatgaatggaaaaaaaaagtgggagattatgttaag
gcggatgaaacgataacaattatcgatacagataaagttagtgttgatataaattctaaa
gtaagtggagggttatccaaaatttttgcggatgtaggagatgttgttttggtagatgca
cctttatgtgaaattgatacatctgtagaaccacctgaagatatttgtaaaactaaagag
gaagtaggagaaagtaaaaataatgaaaataattatacatttaatcaattaaatagagat
attaaagatgaagcacatataaaagatgaagttagtaaaaatgaaaaagatatttttgta
aaagatcctatatgttttggaaatgattatgaatcaataaatgaaagaacagaaagaaga
gtccgtatgttacctataagaaaaagaattgcagaacgattaaaggaatcacaaaataca
tgtgctttattaacaacatttaatgaatgtgatatgtcaaaggcaatgttattaagaagt
gaattaaatgatatatttcaaaaaaaatattcatgtaaattaggatttgtatcattattt
atgtatgcatcaacattggctttaaaaaaaatgccaaatgtaaatgcatatatagaaaat
gatgaaattgtatataaaaattatatagatatatctgtagcagtagctacaccaaatggc
ttaaccgttccagttataagaaattgtcaaaataaaaatttaccacaattagaattagct
ttatctgatttagctacaaaagcacgatcaaataaattatcgattgatgattttagtggt
ggtacatttacaatatctaatggaggtgtttttggtagtatgttaagtactcctattatt
aatatgccacagtcagctattctaggaatgcatacaataaaaaatagaccagtagttgtc
aataatgaaattgttattagaccaattatgtaccttgcccttacatatgatcatagatta
ttagacggaagagaagccgtacaatttttatgtgcaataagagattatatagaaaaccct
aatctaatgttaattgattgttaa

DBGET integrated database retrieval system