KEGG   Plasmodium falciparum HB3: PFHG_05213Help
Entry
PFHG_05213        CDS       T01052                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pfh  Plasmodium falciparum HB3
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 72 aa AA seqDB search
VDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSA
LAVIPNDNFDII
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gttgatacacattttattgtttttgtgcaaattgaaggaaagatcattgaattggtatgt
ttaaattttatttaaaaaaaaatgtatgtgtatctttattattattcccaataaatacat
acatatatatatatatatgtatttatttatttatgtatattctttttaatttttttaaag
gatggaagaaaggatcatcctactgttcactgttttaccaatggagataattttttatat
gtaagtataataatttaataatatatattttttttttttttttcttttcctttttacttt
ttttaatataataataatataaaatcattttatttattttaggatacggggaaaatcata
caagataagtttattgaaaaatgtaaagatgatttaagattttcagcattggccgtaata
ccaaacgataactttgatattatatga

DBGET integrated database retrieval system