KEGG   Plasmodium falciparum HB3: PFHG_05213Help
Entry
PFHG_05213        CDS       T01052                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pfh  Plasmodium falciparum HB3
Brite
Enzymes [BR:pfh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFHG_05213
Peptidases [BR:pfh01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PFHG_05213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 72 aa AA seqDB search
VDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSA
LAVIPNDNFDII
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gttgatacacattttattgtttttgtgcaaattgaaggaaagatcattgaattggtatgt
ttaaattttatttaaaaaaaaatgtatgtgtatctttattattattcccaataaatacat
acatatatatatatatatgtatttatttatttatgtatattctttttaatttttttaaag
gatggaagaaaggatcatcctactgttcactgttttaccaatggagataattttttatat
gtaagtataataatttaataatatatattttttttttttttttcttttcctttttacttt
ttttaatataataataatataaaatcattttatttattttaggatacggggaaaatcata
caagataagtttattgaaaaatgtaaagatgatttaagattttcagcattggccgtaata
ccaaacgataactttgatattatatga

DBGET integrated database retrieval system