KEGG   Plasmodium falciparum HB3: PFHG_05482Help
Entry
PFHG_05482        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pfh  Plasmodium falciparum HB3
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 483 aa AA seqDB search
VKWKTYIGSLDIDYKSIRKETYEDIQLDVQGCNNIYESLDKAIEAEILEGDNIYETDGYG
KQKAKKGMRFLSFPNICIFLLKRFTFDLQRMETVKLNNRFEFYKELDLSKYCNKSGSQYV
LQAVSVHQGNMNSGHYYSFSYKHNENFWLKCDDDKIFRVSEYSVINDNFGGYDLNLDNDL
YDFDISDKIKQRLKNYSAYMLVYVKKSLIPKLIKECDPAVVNPQVVKRCRLEEIINKKRY
KLKDEILEYVKIRVFDKYSYVHKSFHDLPPYGIPSLFNIKFDRSKTVIEAFYKILKIIKR
IYARKSDKHKARMLKRINKNNIHKSITNVKVAHDDDVKKNEPTHDKIKTCEKDISNDASN
KKSPTNNNKNNTSSSISISSNKMDTMRNTRHSCYDINSHEKKEESEENEENADNNKDERI
ISNVGEKKNRNINYNNNNNNNNNNMNVDKIHDRYKETYSKHMKEKSKDEKDIYNNVLIKN
EIT
NT seq 1495 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggaaaacatatattggaagtttagatatagattataaaagtataagaaaagaa
acatatgaagatatccaattagatgttcaaggatgtaataatatatacgaatcattagat
aaagctattgaagctgaaattttagaaggagataatatttatgaaacggatggttatggt
aaacagaaagctaaaaaaggaatgcgattcttaagctttcctaatatatgtatattttta
ttaaaacgatttacatttgatttacaaagaatggaaacagtaaaattaaataatcgtttc
gaattttataaagaattagatttatcaaaatactgtaataaaagtggaagtcaatatgta
ctacaagcagtttcggttcatcaaggaaacatgaacagtggtcattattattcatttagt
tataagcataatgaaaatttctggctaaaatgtgatgatgataaaatttttagagtcagt
gaatattctgttattaatgataattttggtggctatgatttaaatttagataacgattta
tacgatttcgatatatcggataaaataaaacaaaggctaaaaaattatagtgcatatatg
ttagtatatgttaaaaagtccttaataccaaaactaattaaagaatgtgatccagctgtt
gtaaatcctcaagttgttaaaagatgtagactagaagaaatcattaataaaaaaagatat
aaacttaaagatgaaattcttgaatatgttaaaataagagtttttgataaatattcctat
gttcataaatcttttcacgaccttccaccatatggtatcccatcattattcaatatcaaa
tttgatcgtagtaaaacggtcattgaagcattttataaaatattaaaaattattaagagg
atatatgctaggaagagcgataaacacaaagctaggatgttaaaaagaattaataaaaat
aatattcataagtctataaccaatgtgaaagtagcacacgatgacgatgttaagaaaaat
gaaccaacacatgataaaataaaaacatgtgaaaaggatatatctaatgatgcttcaaat
aaaaaatctcccaccaataataataaaaataatactagtagtagtattagtattagtagt
aacaaaatggatacaatgagaaatacgcgccatagttgttatgatataaattcacatgag
aagaaagaagaatcagaagagaatgaagaaaatgcagataataataaagatgaaagaatt
atatccaatgttggggaaaagaaaaatcgaaatattaattataataataataataataat
aataataataatatgaatgttgacaaaatacatgatcgttataaagaaacatattctaaa
catatgaaagaaaaaagtaaagatgaaaaagatatatataataatgttctaataaaaaat
gaaagtaatcatgataataaagaaataataaattgtaataatcatagtaacataa

DBGET integrated database retrieval system