KEGG   Pyrococcus furiosus COM1: PFC_00880Help
Entry
PFC_00880         CDS       T02183                                 

Definition
translation initiation factor IF-6
Orthology
K03264  
translation initiation factor 6
Organism
pfi  Pyrococcus furiosus COM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169422..170105
Genome map
AA seq 227 aa AA seqDB search
MHIEKLDFENSPYLGVFGIATDKVVLIREGLQEKKLEVIREVLKVPVVEASLMKSRIIGV
LGAGNSNAIIVPWYVWDSELEKIKNAFREYGIDTEVVPFQTKYTALGNLILTNDKGALVS
SKFSREEAKKIGDILGVEVERGVIAGIVAVGSAGVVTNKGGLVHPEATDEELEWLSDLFK
VDVYVGTANMGVPYVGSCMLANSYGVVVGHLTTGPEIVKIEEALGFI
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcacatagaaaagctcgactttgaaaattctccatatctcggcgtgtttgggatagct
actgacaaagttgtattaattagggaagggcttcaggagaagaagttagaggttattagg
gaagtccttaaagttcccgttgttgaggctagcttaatgaagtctagaataattggagta
ttgggagctggaaattccaacgcaataatagtcccttggtatgtgtgggattctgagctg
gaaaaaataaaaaatgcttttagggaatatggtattgatacagaagttgttcccttccaa
accaagtatactgccctcggtaacttaatcctaaccaatgacaagggagcgctagtaagc
tcaaagttttcaagggaagaagctaagaaaatcggggacatcttaggagttgaagttgag
aggggagttattgcaggaatagtggctgttggtagcgctggggtagtcacaaacaaggga
gggctcgtccacccagaggccactgatgaggagttagagtggctttcagatctctttaag
gttgacgtgtatgttggaacggctaacatgggcgttccctacgttggttcctgtatgtta
gcgaactcttacggagttgtcgttggtcatctaactactggtcctgaaattgttaagatc
gaagaggcattaggatttatatga

DBGET integrated database retrieval system