KEGG   Pyrococcus furiosus COM1: PFC_02205Help
Entry
PFC_02205         CDS       T02183                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pfi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pfi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfi00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:pfi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
437131..438258
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADVGGWPGHSRVHPALIERAKEVLSEAQKEGTLIDFYVTYAGDDLQL
IMTHKKGVDSPEIHGLAWEAFKKATEVAKELGLYGAGQDLLKDAFSGNVRGLGPSVAEME
ITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEIWDILEHK
RVIMNSPEEMYDILALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPLKYATPTRFDGPPRA
VALGWQISPEGKLIGPVDLFDDPAFDWARQKALEITDYMRRHGPFEPHRLPLEEMEYTTL
PGVLEKLKDRFEPIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaggagagaagataacaataagcgtgataaaagcagacgtcggagggtggcct
ggccattcaagagttcacccagcacttatagagagggcaaaagaagtactaagcgaagct
caaaaagaaggaaccctcatagacttctatgtaacctacgctggagatgacctccagctt
ataatgactcacaagaagggagttgacagcccagagatccacgggctcgcttgggaagca
ttcaaaaaggccacagaagtggcgaaggaactaggcctatatggagctggacaggacctt
ctaaaggatgcatttagtggtaatgttagaggtctaggtccaagcgttgcagagatggaa
ataacactaagaaagagcgaaccaatagttacattccacttagataagactgaaccagga
gcattcaatctcccaatatttagaatgtttgccgatcccttcaacacagcggggctcgta
atagatccaaagatgcacatgggattcaggttcgagatatgggacattctcgagcacaag
agagttatcatgaactctccagaggaaatgtacgatattctagccctaataggagcaaag
agtaggtacgtcattaagagggtgtatccgaaggaagggcacccaattccaaaagatgaa
cccgttgctgttgtatcaactgaaaagctctacgaagtggcaggagagtatgtaggaaag
gatgatccagtggccatagtaagagcacaaagtggtcttccagccctgggagaagttcta
gaaccatttgcattcccacacttggtcagcgggtggatgagaggtagccacaatggtcca
ctaatgccagttccacttaaatatgcaacaccaacaagattcgacggaccaccaagggct
gtagctttaggatggcagataagcccagaaggaaagctcattggtccagttgacttgttt
gatgacccagcattcgactgggcaagacaaaaggccttggagataactgattacatgagg
aggcatggaccatttgagcctcacagactaccactggaggagatggaatacacaactctc
ccaggagtcctagagaagttaaaggacagatttgaacctatagagtga

DBGET integrated database retrieval system