KEGG   Pyrococcus furiosus COM1: PFC_03130Help
Entry
PFC_03130         CDS       T02183                                 

Definition
(GenBank) hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00250  Alanine, aspartate and glutamate metabolism
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFC_03130
Enzymes [BR:pfi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PFC_03130
Peptidases [BR:pfi01002]
 Cysteine Peptidases
  Family C44
   PFC_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase QueC Lipase_3 NAD_synthase tRNA_Me_trans GATase_7
Motif
Other DBs
NCBI-ProteinID: AFN03579
UniProt: I6TW54
Position
complement(579356..580966)
Genome map
AA seq 536 aa AA seqDB search
MKIDIKFRHNYGYLWYEKQGIYVKGYVIHESTLYQKEDLVKLLLEHLEKGVKLENILTTF
YGIFSIAIKTDDKIHLISDTTRTFPMFYAVANDEILISDDTFFIKKKIDGQYNKDLKTEF
LRCGYVTGPETLINGVYQVQAGEIVVISEDGQIMRKFYHDYTVTQDELLKDSSDALKKEF
LKILDKAIKRLILMANGDTIVIPLSGGYDSRAIATMLKKNGYENVILYTYGKPDSTEVRV
AREVAKNLEFEWIFVEQNEDIVDPDYPERDFFLEFYKYAFNHVSTIHLQDFFVFKHLHDN
SVIPKNSIIVPGHSGDFLGGSHLRKLPIPKSKRDVFNTILIKHYIVNEHIKLSPYVVKKI
NEYLNSFSEHTLPYSLDDNWNMKERQAKFIVNSNRTYEFFGYRHAIPLWDLELVEFFRRV
PLEYKTKEVIYSDALRESVFKDFGVVLSQKDVANTMALEFYHRIFHSMEIFRHIRYFAEK
NLPSQIKRPLKDLIQKDENNLYVVAKPLLRKMNRKWYLSEFNGIVAEWCLANLEGV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagatattaaatttaggcataactacggatacctgtggtatgaaaaacaagga
atctacgtgaaaggatatgtaatacacgagagcaccttataccaaaaagaggacttagtc
aagcttttattagagcatcttgaaaaaggtgttaagcttgagaacatactcacaactttt
tatggcattttttcgattgcaattaaaacagatgataaaatacatttgatttcagacaca
acaaggacttttccaatgttttacgctgttgccaatgatgaaattctaatctctgatgat
actttctttattaagaaaaaaatagatggccaatacaataaagatctaaaaacagagttc
ttaaggtgcgggtatgttacaggaccagaaacactaattaatggagtttaccaagtccaa
gcaggagagatagtagttataagcgaagatgggcagattatgagaaaattttaccacgat
tatacagttactcaggatgagcttctaaaagactcttcagatgctcttaaaaaagaattt
ttgaaaattcttgataaagcgataaaaagattgattttaatggcaaatggtgatacgatc
gtcattccactaagcggagggtatgactcgagggccatagctacaatgctcaagaagaat
ggatatgaaaacgttattctctacacgtatggtaagccagattccacagaagtcagagtt
gcgagagaagttgccaaaaatctggaatttgagtggatatttgttgagcagaacgaagat
attgtagatccagattatcctgaaagagatttcttcttggagttttacaaatacgcattt
aatcatgtttccacaatacacttgcaggatttctttgtttttaaacatcttcacgataac
tcggtaattccaaagaattcaataattgtgccggggcattctggagactttctcggaggg
agtcatttgcgcaagctgcccattccaaaatctaagagagatgtttttaatactatactc
attaaacattatatcgtaaacgagcacataaaactttctccatatgtagttaaaaagata
aatgaatacctgaatagtttttctgagcatactctgccttacagcttagatgataactgg
aacatgaaagaaaggcaagctaaatttatagttaactccaacagaacctacgaatttttc
ggctatcgccatgcaatccctctctgggatttagaattggtagaattctttagaagagtt
cccttagaatataagaccaaagaagtaatttacagtgatgctttgcgtgaaagtgtattc
aaggattttggggtagttttatctcaaaaagatgtcgctaatacgatggctctagaattc
taccatcgcattttccattcaatggaaatttttaggcatattcggtatttcgcagaaaaa
aatttaccctctcaaatcaaaagacctctcaaagatttaatccagaaagacgaaaataat
ctttacgtggttgctaagcctctgctgagaaaaatgaatcgcaaatggtatctttcggag
tttaatggaatcgttgcagagtggtgcttggctaacttggagggagtatag

DBGET integrated database retrieval system