KEGG   Pyrococcus furiosus COM1: PFC_04055Help
Entry
PFC_04055         CDS       T02183                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00010  Glycolysis / Gluconeogenesis
pfi00020  Citrate cycle (TCA cycle)
pfi00620  Pyruvate metabolism
pfi00640  Propanoate metabolism
pfi00650  Butanoate metabolism
pfi00680  Methane metabolism
pfi00720  Carbon fixation pathways in prokaryotes
pfi01100  Metabolic pathways
pfi01120  Microbial metabolism in diverse environments
pfi01130  Biosynthesis of antibiotics
pfi01200  Carbon metabolism
Module
pfi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC_04055
   00020 Citrate cycle (TCA cycle)
    PFC_04055
   00620 Pyruvate metabolism
    PFC_04055
   00640 Propanoate metabolism
    PFC_04055
   00650 Butanoate metabolism
    PFC_04055
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PFC_04055
   00680 Methane metabolism
    PFC_04055
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PFC_04055
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PFC_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AFN03760
UniProt: I6UYN2
Position
complement(727472..728467)
Genome map
AA seq 331 aa AA seqDB search
MAVRKPPITTREYWAPGHAACAGCGCATALRLATKALSEAMEEKYGDPNAFAIAHATGCM
EVVSAVFPYTAWKAPWIHVAFENAAAVASGIEAAWKKLGRKGKILAIGGDGGTADIGLQA
LSGMLERWHNVLYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSVGEDKPKKWVALI
AAAHQIPYVATASIGNPLDFVRKIKKAGKIDGPAFVQVLCTCPTGWRSPLEKGVEIARLA
IETGIWPLFEIENGDIWNIKIQPPGGGAKVYKEGNRVVRIEFKKPIEEYLKLQGRFKHLF
KRPEAIEELRNQVKAMWKVLGVEAILPRPEE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagaaagcccccaataactacccgtgaatattgggctcctggtcatgccgca
tgtgcaggttgtgggtgtgctactgctctaaggttagctaccaaggctcttagtgaagct
atggaagagaaatatggagatccaaacgccttcgcaatagctcacgcaactggctgtatg
gaagtagtgtcagctgtattcccatatacagcatggaaggccccctggattcacgtagct
tttgaaaacgctgcagccgtagcgagtggtattgaagctgcatggaagaagcttggaagg
aaaggtaagatattggcaataggtggagatggtggtacagctgatataggactccaagcc
ctctctggaatgctcgaaagatggcacaatgttctctaccttatgtatgacaatgaggct
tacatgaacactggaattcagaggtcttcatcaacaccatatggagcatggaccacaact
tcacctcccggaaagtattcagtaggtgaagacaagccaaagaagtgggtagcacttatt
gcagccgctcatcaaattccctatgtagcaactgcaagcataggaaatccacttgacttc
gtgagaaagataaagaaagcaggcaagattgacgggccagcattcgttcaagtcctctgt
acttgtccgacaggatggagaagtccactggaaaaaggcgttgagatagcaaggctagcc
atagaaacaggtatatggccactcttcgagattgaaaatggtgacatctggaacattaag
atacagcccccaggaggaggagctaaggtttacaaggaaggcaacagagtcgttagaata
gagttcaagaagccaatcgaggagtacctcaagctccaaggaagattcaagcacctcttc
aagagaccagaggccattgaagagcttaggaaccaagtaaaagcaatgtggaaagtctta
ggagttgaagcaatacttccaagacccgaggagtag

DBGET integrated database retrieval system