KEGG   Pyrococcus furiosus COM1: PFC_04065Help
Entry
PFC_04065         CDS       T02183                                 

Gene name
porD
Definition
(GenBank) pyuvate ferredoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00010  Glycolysis / Gluconeogenesis
pfi00020  Citrate cycle (TCA cycle)
pfi00620  Pyruvate metabolism
pfi00640  Propanoate metabolism
pfi00650  Butanoate metabolism
pfi00680  Methane metabolism
pfi00720  Carbon fixation pathways in prokaryotes
pfi01100  Metabolic pathways
pfi01120  Microbial metabolism in diverse environments
pfi01130  Biosynthesis of antibiotics
pfi01200  Carbon metabolism
Module
pfi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC_04065 (porD)
   00020 Citrate cycle (TCA cycle)
    PFC_04065 (porD)
   00620 Pyruvate metabolism
    PFC_04065 (porD)
   00640 Propanoate metabolism
    PFC_04065 (porD)
   00650 Butanoate metabolism
    PFC_04065 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PFC_04065 (porD)
   00680 Methane metabolism
    PFC_04065 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PFC_04065 (porD)
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PFC_04065 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_16 Fer4_10 Fer4_9 Fer4_4 Fer4_17 Fer4_22 Fer4_15 Fer4_8 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AFN03762
UniProt: I6U715
Position
complement(729679..729996)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELSEKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaggccgatatagaaagagcccaaaaagagttaagtgaaaaa
atgacacccggagcaatagtctacattccaggaagtagcgtcattaataaaactggatct
tggagagtttttaagccagagttcaacagggacaagtgtgtaaggtgttatctctgctac
atctactgtccagagcctgcaatatacctagatgaagaaggttacccagtttttgactac
gactattgtaagggttgtggaatctgtgctaatgagtgtccaacaaaagccattgaaatg
gttagagaagttaagtga

DBGET integrated database retrieval system