KEGG   Pyrococcus furiosus COM1: PFC_04065Help
Entry
PFC_04065         CDS       T02183                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:pfi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pfi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pfi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pfi00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:pfi00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(729679..729996)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELSEKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtccgtttaaggccgatatagaaagagcccaaaaagagttaagtgaaaaa
atgacacccggagcaatagtctacattccaggaagtagcgtcattaataaaactggatct
tggagagtttttaagccagagttcaacagggacaagtgtgtaaggtgttatctctgctac
atctactgtccagagcctgcaatatacctagatgaagaaggttacccagtttttgactac
gactattgtaagggttgtggaatctgtgctaatgagtgtccaacaaaagccattgaaatg
gttagagaagttaagtga

DBGET integrated database retrieval system