KEGG   Pyrococcus furiosus COM1: PFC_04075Help
Entry
PFC_04075         CDS       T02183                                 

Gene name
vorA
Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.7)
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFC_04075 (vorA)
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     PFC_04075 (vorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(730986..732170)
Genome map
AA seq 394 aa AA seqDB search
MEYKPIRKVVSGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAEFIANGEADIQYIPVE
SEHSAMAACIGASATGARTFTATSAQGLALMHEMLHWAAGARLPIVMVDVNRAMAPPWSV
WDDQTDSLSQRDTGWMQFYAENNQEVYDGVLMAYKVAETVNVPAMVVESAFILSHTYDVV
EMIPQELVDEFLPPRKPLYSLANFDEPIAVGALATPNDYYEFRYKLAKAHEEAKKVIKEV
GKEFGERFGRDYSQMIETGYIDDADFVFMGMGSLMGTVKEAVDLLRKEGYKVGYAKVRWF
RPFPKEELVEIAESVKGIAVLDRNFSFGQEGILFTESKGALYNSSAHPLMKNYIVGLGGR
DVTVKDIKAIADDMKKVIESGKVDKEVVWYHLKR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaaccaattagaaaagttgtgagtggcaactatgctgcagcttatgcagcc
cttcatgcgagagttcaagttgttgccgcttatcctattacccctcaaaccagcatcatt
gaaaaaattgcagagtttatagccaatggtgaggctgacattcaatatatacccgtcgaa
agcgagcactctgctatggcagcttgtataggcgcatcggctactggagctagaacattt
actgcaacttctgctcagggattagctctaatgcatgaaatgcttcattgggctgctgga
gcaaggcttccaattgttatggttgatgtaaacagagcaatggctccaccttggagtgtg
tgggatgatcaaactgattctctctcacaaagagacactgggtggatgcagttctacgct
gaaaacaaccaagaagtttacgacggtgtcctaatggcatacaaagttgcagagacagtc
aacgttcccgcaatggtagttgagagcgcatttattctcagccacacatatgacgtcgtt
gaaatgattccacaggaacttgttgacgagtttttaccaccaaggaagcccttgtatagc
ttagcaaacttcgatgagcccatagcggtaggagcccttgcaacaccaaacgattactat
gagtttagatataagttagctaaggctcatgaagaggccaaaaaagtcattaaggaagtc
ggaaaagaatttggagagcgctttggtagagactatagtcaaatgattgagacaggctac
atcgatgatgcagacttcgtatttatgggtatgggttccctaatgggtaccgtaaaggaa
gcagtcgacctcttaagaaaagaaggttataaagtaggatacgcaaaagttagatggttt
agaccattcccgaaggaagagctagtagaaattgcggagagcgttaagggaatagccgtt
cttgatagaaacttctcctttggacaagagggaattctcttcacggagagcaagggcgcg
ctctataactcttcagctcacccattgatgaagaactatatagttggccttggaggaagg
gatgttactgtaaaagacattaaggcaatagcagatgatatgaagaaagtcattgagagt
ggaaaagtggataaagaagttgtttggtaccatcttaagaggtga

DBGET integrated database retrieval system