KEGG   Pyrococcus furiosus COM1: PFC_04085Help
Entry
PFC_04085         CDS       T02183                                 

Definition
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFC_04085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC_04085
   00020 Citrate cycle (TCA cycle)
    PFC_04085
   00620 Pyruvate metabolism
    PFC_04085
   00640 Propanoate metabolism
    PFC_04085
   00650 Butanoate metabolism
    PFC_04085
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PFC_04085
   00680 Methane metabolism
    PFC_04085
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PFC_04085
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PFC_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(732537..733094)
Genome map
AA seq 185 aa AA seqDB search
MIEVRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDNKPIRI
KTQIYEPDVVVVLDPSLLDAVDVTAGLKDEGIVIVNTEKSKEEVLEKLKKKPKKLAIVDA
TTIALEILGLPITNTAILGAVAKATGLVKIESIEEAIKDTFSGELGEKNARAAREAYEKT
EVFEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagttcgctttcacggtagaggaggtcaaggtgcagttaccgctgcaaacatt
cttgctgaagcagcgtttctagaaggtaaatacgtgcaggctttcccattctttggagtt
gaaagaagaggagctccagtaacagctttcacaaggatagacaacaaaccaattaggata
aagactcaaatttatgaacccgacgttgttgttgtgctagatccctctctcttagatgct
gtagacgtaactgctggtcttaaagatgagggaattgtcatagtgaatacagaaaagagc
aaagaagaagttctcgaaaagttaaagaaaaagccaaagaagctcgctatagttgatgca
actacgatagctcttgaaattcttggattgcccattacgaatactgccatattgggagct
gttgcaaaggccacagggctagtcaagattgagagcatagaggaagccatcaaagacaca
ttctctggggagcttggtgaaaagaacgcaagggctgcaagagaagcttacgaaaaaaca
gaagtatttgagctttaa

DBGET integrated database retrieval system