KEGG   Pyrococcus furiosus COM1: PFC_04250Help
Entry
PFC_04250         CDS       T02183                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pfi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763364..764848
Genome map
AA seq 494 aa AA seqDB search
MKKITISSLLLLLLISTNLNLAYDSQESGIKNIIILIGDGMGMSHVQITKLVYGHLNMEE
FPIIGFELTESLSGEVTDSAAAGTAIATGVKTYNRMISVTNITGKVTNLTTLLEIAQVLG
KSTGLVTTTRITHATPAVFASHVPDRDMEEEIARQLIAHRVNVLLGGGRKKFDENTLKMA
KEQGYNIVFTKEELEKAEGEFILGLFADSHIPYVLDRKPEDVGLLEMTKKAISILEKNPN
GFFLMIEGGRIDHAAHENDIASVVAETKEFDDVVGYVLEYAKKRGDTLVIVLADHETGGL
GLGLTYGDAINEDVIRNINASVSKIASEIRATNDIKRVIKKYTGFELTEDEINYIEEAIN
LADEYALQNAIADIINKRVGVGFVSHKHTGAPVSLLAYGPGAENFAGFLHHVDTAKLIAK
LMLFGKKDIPVTILGISGVKGDITGDFKVDEQDAYVTLMMLLGERVDTELERKVDMNNNG
IIELGDVLLILQES
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataactattagtagtttgcttctacttttacttatttctaccaatttgaat
ctcgcatacgattcccaagagagcggtattaaaaatataataatcctcattggagacggc
atgggaatgagtcatgtccagattacaaagcttgtttatggtcatctaaacatggaagag
ttcccaattattggattcgaacttactgagtcattaagtggggaagttacggactccgct
gcagcaggaactgcaatagcaactggagtcaaaacatataatcgaatgatttcagttact
aacataactggaaaagttacaaatctaactaccttgcttgaaatagcccaggtacttgga
aaatcaactggacttgtgactactactagaattacacacgcaacccctgcagtatttgct
tcccacgttcctgacagagatatggaagaggaaatagcgagacagctcatagctcaccgg
gtcaacgtcctattaggtggagggagaaagaaatttgacgagaataccctaaaaatggca
aaagaacagggatataatatagtcttcacgaaagaagagctcgagaaagcagagggtgag
tttattctagggctttttgcagatagccacattccttacgtattggacagaaaaccagaa
gatgttggacttttggaaatgactaaaaaagcaatttcaatactagagaaaaatccaaat
gggttctttctcatgattgaagggggcagaattgatcatgcagctcatgagaatgatata
gcatcagttgttgcagagactaaggagtttgatgacgttgttggatatgttcttgagtat
gcaaaaaagaggggagatacactagtaatagtgctggctgaccatgagacaggggggctt
ggattaggtctaacatatggagatgcaattaatgaagatgtcatcaggaacataaacgct
agtgtgtcgaaaattgctagtgaaataagggcaacgaatgacataaagagagttatcaaa
aaatatactggattcgagctaacagaggacgaaattaattacattgaggaagctataaac
ttagcagacgaatatgcgcttcaaaatgcaatagctgatattataaacaaacgcgttggt
gtaggttttgtatcccacaaacatacaggagctcctgtttcacttctagcctacggccca
ggtgcagagaattttgcaggctttttacaccatgtagatacggcaaagctaattgccaag
ctaatgctctttgggaagaaagatattcccgttaccatcttgggaataagtggagttaaa
ggagatataaccggagacttcaaagtggatgagcaagatgcatatgtgaccttaatgatg
ttgcttggggaaagggtagatactgaacttgaaaggaaagtcgacatgaataataacggc
ataatcgagttgggagacgtgctcctgattctacaagagtcctaa

DBGET integrated database retrieval system