KEGG   Pyrococcus furiosus COM1: PFC_04510Help
Entry
PFC_04510         CDS       T02183                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00260  Glycine, serine and threonine metabolism
pfi00750  Vitamin B6 metabolism
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
pfi01120  Microbial metabolism in diverse environments
pfi01230  Biosynthesis of amino acids
Module
pfi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_04510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFC_04510
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFC_04510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFN03851
UniProt: I6UPU6
Position
811171..812355
Genome map
AA seq 394 aa AA seqDB search
MVLKCVVCGREYPEDEVRYRCECGGLLEVVIDLDKVDTSIFNGKEIKLWKYESWLPVKKR
VSLEEGGTPLYRLLNLESDLGVKELYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVIC
ASTGNTSASLAAYAAKAGIKAYVLIPSGKIALGKLAQAIIYGARVVPIKGNFDDALRVVV
ETSKELGIYMLNSINPFRLEGQKTIAYEIYDQLGKVPDNVILPVGNAGNISAIWKGFKEM
YEAGVIDELPRMIGIQAEGASPLAKAWKEKRKFQPEESPETIASAIRIGNPANWIKAWRA
VEESGGLFESVSDEEILRAQKLLASREGLFVEPASAASLAGLIKLLESGEISRNESYVLI
TTGHGLKDPNIVIKNFQVPEPIDPTLEAFKEVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaatgtgtagtctgtgggagagagtatcctgaagacgaagttaggtatagg
tgtgagtgtggaggtctattagaggttgttatcgatctagataaagttgatacttccatt
tttaacggtaaggagataaagctgtggaaatatgaaagctggctacccgtaaagaagaga
gttagtctggaagaaggtggaactcccctatataggttattaaatcttgaaagtgatctt
ggagtaaaagagctctatgcaaaaaacgagggtgcgaatccaacaggttcatttaaagac
cgcggaatgacggttggagtctcgaaggctcttgagctaggaatggataaagtcatatgt
gcatctacgggaaatacttcagcatcacttgctgcttatgctgcaaaagcaggaataaaa
gcatatgtcctaatcccaagtgggaagatagcgttaggaaagcttgctcaagcaataatc
tatggggctagggttgtaccaatcaaggggaactttgacgatgctctaagagtagtcgtg
gagacaagcaaagaacttgggatatacatgttaaattcaataaacccattcaggctcgaa
ggacaaaagacaatagcgtatgagatatatgaccaacttggaaaagttccagacaacgtt
attctcccagttggaaatgcaggaaacatttctgcaatatggaaggggtttaaggagatg
tatgaggctggcgtaatagatgaacttcccaggatgataggaattcaagcagaaggagca
tccccattagcgaaggcttggaaagagaaaagaaaattccaacccgaagagagtccagaa
accattgcatcggccataagaataggaaaccccgcaaattggataaaggcatggagggct
gttgaagaatctgggggactatttgagagcgtaagtgatgaggaaatactaagagctcag
aaacttctagcgtctagggaaggactatttgttgaacctgcttctgcagcatctttagct
ggcttaattaagctccttgaaagtggtgaaataagcaggaatgagagttacgttttaatc
acaactggacatgggctaaaagatccaaatatcgtcataaagaacttccaagttccagaa
cctatagacccaactttagaagcttttaaggaggtgattgaatga

DBGET integrated database retrieval system