KEGG   Pyrococcus furiosus COM1: PFC_04580Help
Entry
PFC_04580         CDS       T02183                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pfi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823438..824853
Genome map
AA seq 471 aa AA seqDB search
MCLITGGINLTKEEIVKMIITGKHRGPDSFGVWSDGLVIKSEDFSEIKEIRGGNVVLAQC
RLAMTGSKNYTQPFYNDIVLVHNGEIYNHESLRKWLIERGASFESDVDSEVILRLLEYFI
FDKKMKVEEAVKKAMLMLRGDYAVAFALNGKIYLFRDPIGVRPLYYSPRGRFGSEKKVLW
SVGEEAIPVNPGELVKLPEEEKMKLLSPWDIKGSGKGYYDGLKNLLQDAVRIRTAKKVGV
LFSGGLDSSLIALLASKYSKVVLYTAGTEDSKDVEWARKVSDELRLELREYIFTREEVER
EIKNVMFAIEEPNPMNLAIAIPLYFATKLARKDDVKVLLSGQGADELFGGYAKYLENPSL
MRKDIEEIAERNLGRDDKVGMLNGVEVRYPYLDLPFVSLALRVPLEEKIREGVRKAILRR
IALDFGLPEEVAFREKKAAQYGSNAQKILSKIAKKSLREFAQKLFSEVFST
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctaataaccggaggaataaatctaacaaaggaagaaatcgtcaagatgataatt
actggaaagcatagaggaccagattcttttggcgtatggagcgatgggttagttataaaa
tctgaggacttctcagagataaaagaaattagagggggcaacgttgttttagcccagtgt
aggcttgcaatgactggatctaaaaactatacccaacccttttacaatgacattgttctc
gtccacaatggagagatatataaccacgaaagtttgaggaagtggttaatagagagggga
gcatcatttgagagtgacgtggacagtgaggttatcctaagacttttggagtattttata
tttgacaaaaagatgaaagttgaggaggccgttaaaaaagcgatgcttatgttgagggga
gactacgccgtcgcatttgctctcaatggtaaaatctatttgtttagggatcctattgga
gttagaccactctactattccccaagggggaggtttgggtcagagaagaaggtgttgtgg
agtgtaggtgaagaagcaataccagttaacccaggtgagctcgttaagttgccagaagaa
gagaagatgaagctactttccccctgggacattaaaggttctggaaaaggatactacgac
ggtcttaagaatttacttcaagatgctgtaagaataaggacagctaaaaaagttggagtg
ctcttttcaggaggattggacagctcattaatagctttgttagcttcaaaatactctaag
gtagttctctacactgcgggaacggaggatagtaaagacgttgagtgggccagaaaagtt
agtgatgagcttagacttgagcttagagagtatatatttacccgggaggaagttgagagg
gagattaagaatgtaatgttcgctatagaggagccaaatccaatgaacttagccattgca
attcctctatattttgccacaaagcttgctaggaaggatgatgttaaggtccttttgagt
ggccagggtgctgatgaactgtttggaggatatgcaaagtatctcgagaatccctctttg
atgagaaaagatatagaggagatagccgagagaaacttaggtagagatgataaagtggga
atgctaaatggtgtggaagttagatacccctacttggatttgccctttgtctctctagcc
ttaagggttcccctagaagaaaagataagagagggagttagaaaggcaattttgaggaga
attgcactagattttggcttgccagaagaagttgcctttagggagaaaaaggccgcacaa
tacgggagcaatgctcagaagatactctctaagatagcaaagaagagtcttagagaattc
gcccagaagttattttctgaggtattctctacataa

DBGET integrated database retrieval system