KEGG   Pyrococcus furiosus COM1: PFC_04750Help
Entry
PFC_04750         CDS       T02183                                 

Definition
pyrazinamidase/nicotinamidase pxnc
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PFC_04750
Enzymes [BR:pfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PFC_04750
    3.5.1.-  
     PFC_04750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854636..855172
Genome map
AA seq 178 aa AA seqDB search
MPEEALIIVDMQRDFMPGGALPVPEGDKIIPRINDYIKEFKEKGALIVATRDWHPENHIS
FKERGGPWPKHCVQNTPGAEIVVDLPEDAIIISKATEPDKEAYSGFEGTNLAEILKKNGV
KRVYICGVATEYCVRATALDALKHGFEVYLLKDAVKGINPEDEKKVLRELEEKGVKIL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaagccctcattattgttgacatgcaaagagacttcatgcccggtggggct
cttccagtacctgaaggtgacaaaataattcccagaataaatgactacataaaagaattc
aaggagaagggagctttgatagttgcgacgagagactggcaccctgaaaatcatataagc
tttaaggaaagaggtggaccatggccaaagcactgtgttcagaataccccaggagcggag
atagtggtcgatcttccggaggatgcaataataatttcaaaggccactgagccagataag
gaggcgtattcaggatttgaggggactaacttagctgagatcctcaagaagaatggcgta
aagagggtttacatctgcggtgttgcaactgaatactgtgtgagagctacggccttagat
gccctaaagcatggtttcgaagtttatcttctcaaagatgccgtgaagggaataaacccc
gaagacgaaaagaaagtcctgagggagttagaggagaaaggagttaagattctctag

DBGET integrated database retrieval system