KEGG   Pyrococcus furiosus COM1: PFC_04750Help
Entry
PFC_04750         CDS       T02183                                 

Definition
pyrazinamidase/nicotinamidase pxnc
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pfi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854636..855172
Genome map
AA seq 178 aa AA seqDB search
MPEEALIIVDMQRDFMPGGALPVPEGDKIIPRINDYIKEFKEKGALIVATRDWHPENHIS
FKERGGPWPKHCVQNTPGAEIVVDLPEDAIIISKATEPDKEAYSGFEGTNLAEILKKNGV
KRVYICGVATEYCVRATALDALKHGFEVYLLKDAVKGINPEDEKKVLRELEEKGVKIL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaagccctcattattgttgacatgcaaagagacttcatgcccggtggggct
cttccagtacctgaaggtgacaaaataattcccagaataaatgactacataaaagaattc
aaggagaagggagctttgatagttgcgacgagagactggcaccctgaaaatcatataagc
tttaaggaaagaggtggaccatggccaaagcactgtgttcagaataccccaggagcggag
atagtggtcgatcttccggaggatgcaataataatttcaaaggccactgagccagataag
gaggcgtattcaggatttgaggggactaacttagctgagatcctcaagaagaatggcgta
aagagggtttacatctgcggtgttgcaactgaatactgtgtgagagctacggccttagat
gccctaaagcatggtttcgaagtttatcttctcaaagatgccgtgaagggaataaacccc
gaagacgaaaagaaagtcctgagggagttagaggagaaaggagttaagattctctag

DBGET integrated database retrieval system