KEGG   Pyrococcus furiosus COM1: PFC_05225Help
Entry
PFC_05225         CDS       T02183                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFC_05225
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFC_05225
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PFC_05225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
946056..947915
Genome map
AA seq 619 aa AA seqDB search
MYGWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEARGVEPLSPENKLIF
AAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPVY
IYIEDDNVSILSAEGLWGKTTFETERELKEIHGKNVGVLTIGPAGENLVKYAVVISQEGR
AAGRPGMGAVMGSKKLKAVVIRGTKEIPVADKEELKKLSQEAYNEILNSPGYPFWKRQGT
MAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTMEGMKVQQRGCPYCNMPCGNVVLDAEG
QESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGMDTISLGVSIAHVMEAVERGILKE
GPTFGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGTHDFAMHVKGLEVSGYNCYI
YPAMALAYGTSAIGAHHKEAWVIAWEIGTAPIEGEKAEKVEYKISYDPIKAQKVVELQRL
RGGLFEMLTACRLPWVEVGLSLDYYPKLLKAITGVTYTWDDLYKAADRVYSLIRAYWVRE
FNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSEYYRIRGWDERGIPKKETL
KELDLDFVIPELEKVTNLE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatggtggggtaggattctaagggtaaacctaacaactggagaagttaaggtt
caggaataccccgaagaagttgccaagaaatttattggaggtagaggattagccgcctgg
attctttggaatgaagctagaggtgttgagccccttagtccagaaaacaagttaatcttt
gctgctggtcccttcaatggccttccaaccccgagcggtggaaagcttgtagttgcggct
aagagtcctctaactggaggttatggtgacggcaacctaggaacaatggcttctgttcac
ttgagaagggcaggttatgatgctctcgttgttgaaggtaaggcaaagaagcccgtctac
atttatatcgaagatgacaacgttagcatccttagtgctgaaggtctatggggtaagaca
acattcgagaccgagagagaattaaaggaaatccatggcaagaacgtcggcgttttaacc
atcggaccagccggagaaaatttagttaaatatgctgttgttatctcccaggagggaaga
gctgctggaagacctggaatgggtgctgtaatgggaagcaagaagttaaaggccgtagta
ataaggggaaccaaggagataccagttgcagacaaggaagagttaaagaagctcagccag
gaggcatataatgaaattctaaactctccagggtatccattctggaagagacaggggacc
atggcagctgtagagtggtgtaatactaactatgccctcccaacaaggaacttcagcgat
ggctacttcgaattcgctcgttcaatagatggttacacaatggaggggatgaaggtacag
cagaggggctgtccctactgtaacatgccgtgtggaaatgtagtgcttgatgcagagggc
caagagagtgagcttgactatgaaaatgtagccttgctgggttcaaaccttggaataggg
aagcttaacgaggtttcagttctcaacaggatagctgacgagatgggtatggacacgata
agcctcggtgtttcaatagcccacgtaatggaggctgtggagagaggaatcctcaaggaa
gggccaacatttggagacttcaagggagctaagcaattggccttggatatagcttacaga
aaaggagagctcggcaacttagctgcagagggagttaaggctatggccgagaagcttgga
actcatgatttcgcaatgcacgttaagggattagaggttagtggttacaactgttacatc
tacccagcaatggcattagcttatggaacgagcgcaatcggtgcacaccacaaggaggca
tgggttattgcatgggaaatcggtactgccccaattgaaggagagaaggccgagaaggtg
gagtacaagataagttacgatccaataaaggcccagaaagttgttgagttgcagaggttg
agaggtgggctcttcgagatgcttacggcatgtaggctaccatgggttgaggttggccta
agcctagactactatccaaagctcctcaaggcaataactggagtcacctacacctgggat
gacctttacaaggcagctgacagggtttattccctcataagagcttattgggtgagagaa
ttcaacggcaagtgggatagaaagatggattacccaccaaagagatggttcacagaggga
ctgaagagtggcccgcacaagggagagcacctcgatgagaagaagtacgatgagttgctc
tcagagtactacagaataaggggatgggacgagagaggaattccaaagaaggaaactttg
aaagagcttgacctcgacttcgtaattcctgagctggagaaggttacaaaccttgagtga

DBGET integrated database retrieval system