KEGG   Pyrococcus furiosus COM1: PFC_05695Help
Entry
PFC_05695         CDS       T02183                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1020440..1021264
Genome map
AA seq 274 aa AA seqDB search
MKFAGVSLDTPKVMGVINVSPESFFKGSVKRGEELIETAVRMVEEGAAFIDIGAKSTAPY
LETEIPVEEEIRRAVEAIRAIRDAVDVPISIDTTNAKVAEEAIKAGADIVNDVTGLKGDP
EMVKVVKEYDVPVVICAHQENVRNFSDPVHEVIDSLKESLQIAYKNGIEKENIAIDPAIG
FFRPEYPPWYVWDSKVIANLKLLKVFGLPILVGISRKSFIGAITGREDPSERLEGSLAAT
AIAVLNGANIIRAHDVKETLDVIKVADFIRRFTL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgctggagtttcgttagatactcccaaagtaatgggagtcataaacgtttcc
cctgaaagcttcttcaaggggagtgtgaagagaggagaagagcttatagaaacagcggta
agaatggttgaagagggggcggcgtttatagatattggcgcaaaatcaactgctccctac
ttagaaactgagataccagttgaagaggaaattagaagggccgttgaagctataagagct
attagagatgctgtagatgtcccgataagtattgacacaactaatgctaaggttgctgag
gaagcaataaaagctggggcagacattgtgaacgatgtaactgggcttaagggagaccca
gagatggttaaagttgttaaagaatatgatgtccccgtcgttatatgtgcacatcaagaa
aatgtaaggaacttttcagatccagttcatgaagtgatagactccttgaaggaaagtctt
cagatagcatacaaaaacgggatagagaaagagaacatagcaatagacccagccatagga
tttttcaggcccgaatatcctccctggtatgtttgggattcgaaggtaatagcgaattta
aagttactgaaagtctttggacttccaattttagttggaatatcaaggaagtcattcatt
ggagctataacgggaagggaggatccaagtgaaaggcttgaaggaagcttggccgctacg
gcgatagctgtgttaaatggagcaaacataataagagctcatgacgtcaaagaaacccta
gatgtaataaaggttgcagacttcattcggagattcactctatag

DBGET integrated database retrieval system