KEGG   Pyrococcus furiosus COM1: PFC_05995Help
Entry
PFC_05995         CDS       T02183                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFC_05995
   00052 Galactose metabolism
    PFC_05995
   00500 Starch and sucrose metabolism
    PFC_05995
   00520 Amino sugar and nucleotide sugar metabolism
    PFC_05995
Enzymes [BR:pfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PFC_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072216..1073067
Genome map
AA seq 283 aa AA seqDB search
MKVRKAVIPAAGLGTRMLPLTKAQPKEMLPVVRKPTIQYVLEEAYEAGIREVLIITGKHK
RAIEDHFDRYEHEVKNPHLDKLDKILDDINIYYARQRVQRGLGDAIKYAEAFVGDEPFAL
LLGDTITLPSCTAGIIESYEELKAPVIAVEEVQEEKISLYGVVGIGRYINERIFEINKLV
EKPEIHEAPSNLAILGRYILTPEIFEYLEEVKPDKKGEIQLTDALELMVQNGKKIYGYVF
KGRRYDIGNIFDWLRANIELGLEDEELSEKLRELIKSLVGERI
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgagaaaagcggtaattccagcagcaggccttggaacaagaatgttaccactg
actaaagcacaaccaaaagaaatgctccctgttgtgagaaagccaactatccaatatgtt
ctcgaagaagcttatgaggctgggatacgagaagttttgataataacgggaaaacataag
agggcaatcgaagatcatttcgatagatatgagcatgaagtgaaaaatccacatcttgac
aaattggataaaatcctcgatgatataaatatctactatgctagacagagagtacaaagg
ggattgggggatgctatcaaatatgcagaggctttcgttggcgatgaaccctttgctctc
ctcttgggggatactattacactcccttcttgtactgctggaataatagaatcctatgaa
gaattaaaggccccggtaatcgctgtggaagaagttcaagaggagaaaatttctctctat
ggagttgttgggatagggagatatattaatgaaagaatatttgagataaacaagctagtt
gaaaagccagaaattcacgaagctccatcaaatttggccattttaggaaggtacatttta
acccccgaaatctttgagtatttggaggaggtaaagcctgataaaaagggagaaatacag
ctcacagatgctctagagttaatggttcagaatgggaagaaaatttacggctatgtgttt
aagggcaggcgttatgacattggtaacatttttgattggctacgggcaaatattgaatta
ggattagaagatgaagaacttagtgaaaagctaagagaacttatcaaatcgttagtgggg
gaaagaatatga

DBGET integrated database retrieval system